SecReT4
Protein ID: 210134726
T4SS name [ID]Cag [35]
Gene symbolcag5
Locus tagHPP12_0531
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]555963..558209 [-]
Productcag pathogenicity island protein Beta
Component typeCagbeta
UniProt IDB6JLA7
KEGG IDhpp:HPP12_0531
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.4e-180, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.7e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.7e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|210134726|ref|YP_002301165.1| cag pathogenicity island protein Beta [Helicobacter pylori P12]
MEDFLYNTLYFIEDYKLVVIFSFIGLIALFFLYKFIKAQKKAFKDKANQPQKKKSFKEIIIDGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNRSPESDDDLFDIWIYAIQDFPAYYFKALCFSSLKIYG
FNISLVVYSSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRAF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRALSPATRNMWNSFKTMGGARETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDEVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPNQATFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c558209-555963 Helicobacter pylori P12 chromosome, complete genome
ATGGAAGACTTTTTGTATAACACCTTATACTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTCCTCTACAAATTCATAAAAGCTCAAAAAAAGGCTTTTAAAGATAAAGC
TAATCAGCCTCAAAAGAAAAAAAGCTTTAAAGAAATCATTATAGATGGGCTAAAAGAAAGGGTTAAAACC
TTTGGCTTTTGGTTGCAAGCTATACTATTACTATCCTATTCTTTTATCACATCAGGGTTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGACGATAATCGATCGCCTGAGAGTGATGATGATCTTTTTGATATATGGAT
CTATGCGATACAAGATTTTCCTGCATACTATTTTAAGGCGCTTTGTTTTAGTTCACTCAAGATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATATCTTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGAGACATAGGAGCGAATAAAAAAGTTGACGATCTCTTTGGTAGTGC
GAGTTGGGAAACTGAAGAAAAGATGATCAAAGCTAAACTTATCACACCCAATAATAAAAAACGCGCCTTT
GACAAACGAGAGGTGATTGTAGGTAGGCGTGGTTTAGGGGATTTTATCGCTTACGCAGGACAGGCGTTCA
TTGGCTTGATCGCTCCCACTAGAAGCGGTAAGGGTGTGGGTTTCATCATGCCCAATATGATCAATTACCC
TCAAAACATCGTCGTTTTTGACCCTAAGGCTGACACTATGGAAACTTGCGGAAAAATCAGAGAAAAACGC
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGCTTCAATCCTTTCGCGTATG
TGGATTTTGGTAATGATGTGGTTTTGACTGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGGATGGTGGCTAGTGGGGGGGATTTTTCCACTCAAATCTTTGGATTGGCAAAGCTCGTGTTCCCTGAA
AGACCTAATGAAAAAGATCCTTTCTTTAGCAATCAAGCGCGAAATCTTTTTGTCATCAATTGCAATATTT
ATAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCTACGATGTTTTTCATAGGTTCTATGGCAAGCGGGATCAACTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTTTAATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGATAATCTAAGAGCGCTTA
GTCCTGCCACTAGAAACATGTGGAATAGCTTCAAGACAATGGGTGGCGCTAGAGAAACTTATAGCTCTGT
TCAAGGGGTATATACTTCAGCCTTTGCTCCTTATAATAACGCCATGATTAGAAATTTCACGAGTGCTAAT
GATTTTGATTTCAGGCGCTTAAGGATCGATGAAGTGAGTATTGGTGTGATCGCTAATCCTAAAGAAAGCA
CTATTGTTGGACCGATACTAGAGCTGTTTTTCAATGTGATGATTTATAGCAACCTTATTCTGCCAATCCA
TGACCCACAATGCAAAAGAAGTTGCTTGATGCTTATGGATGAATTTACGCTCTGTGGCTATTTAGAGACC
TTTGTTAAAGCGGTAGGGATTATGGCAGAATACAACATGCGCCCCGCTTTTGTGTTTCAAAGTAAGGCGC
AACTAGAGAATGACCCCCCACTTGGTTATGGTAGGAATGGCGCTAAGACTATTTTAGACAACCTTTCTTT
GAATATGTATTATGGGATTAACAACGATAACTACTATGAACATTTTGAAAAACTTTCTAAGGTGTTAGGG
AAATACACAAGGCAAGATGTGAGCCGAAGCATTGATGACAATACAGGTAAGACCAACACTTCTATCAGCA
ACAAGGAGCGGTTTTTGATGACCCCTGATGAATTGATGACTATGGGCGATGAACTTATCATTTTAGAAAA
TACGCTCAAACCCATCAAATGCCACAAGGCGCTTTACTATGATGATCCCTTTTTCACTGATGAGCTCATT
AAGGTGAGTCCAAGCTTGAGCAAGAAATACAAATTGGGGAAAGTGCCAAATCAAGCAACTTTTTACGATG
ACTTGCAAGCCGCTAAAACTAGAGGTGAATTGAGCTATGACAAGTCTTTAGTGCCTGTGGGTTCAAGCGA
ACTGTGA
 Primer design