SecReT4
Protein ID: 210134729
T4SS name [ID]Cag [35]
Gene symbolcagY
Locus tagHPP12_0534
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]559964..565669 [-]
Productcag pathogenicity island protein Y VirB10-like protein
Component typeCagY
UniProt IDB6JLB0
KEGG IDhpp:HPP12_0534
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 0, Aligned region: 305..331
CagY_M [PF07337], Evalue: 0, Aligned region: 339..366
CagY_M [PF07337], Evalue: 0, Aligned region: 376..404
CagY_M [PF07337], Evalue: 0, Aligned region: 418..450
CagY_M [PF07337], Evalue: 0, Aligned region: 452..481
CagY_M [PF07337], Evalue: 0, Aligned region: 487..519
CagY_M [PF07337], Evalue: 0, Aligned region: 521..544
CagY_M [PF07337], Evalue: 0, Aligned region: 556..588
CagY_M [PF07337], Evalue: 0, Aligned region: 595..627
CagY_M [PF07337], Evalue: 0, Aligned region: 633..665
CagY_M [PF07337], Evalue: 0, Aligned region: 666..694
CagY_M [PF07337], Evalue: 0, Aligned region: 702..734
CagY_M [PF07337], Evalue: 0, Aligned region: 740..772
CagY_M [PF07337], Evalue: 0, Aligned region: 779..811
CagY_M [PF07337], Evalue: 0, Aligned region: 817..849
CagY_M [PF07337], Evalue: 0, Aligned region: 850..874
CagY_M [PF07337], Evalue: 0, Aligned region: 886..918
CagY_M [PF07337], Evalue: 0, Aligned region: 924..956
CagY_M [PF07337], Evalue: 0, Aligned region: 962..994
CagY_M [PF07337], Evalue: 0, Aligned region: 995..1023
CagY_M [PF07337], Evalue: 0, Aligned region: 1031..1063
CagY_M [PF07337], Evalue: 0, Aligned region: 1069..1101
CagY_M [PF07337], Evalue: 0, Aligned region: 1108..1139
CagY_M [PF07337], Evalue: 0, Aligned region: 1142..1167
CagY_M [PF07337], Evalue: 0, Aligned region: 1177..1209
CagY_M [PF07337], Evalue: 0, Aligned region: 1216..1247
CagY_M [PF07337], Evalue: 0, Aligned region: 1250..1275
CagY_M [PF07337], Evalue: 0, Aligned region: 1285..1317
CagY_M [PF07337], Evalue: 0, Aligned region: 1324..1355
CagY_M [PF07337], Evalue: 0, Aligned region: 1363..1397
CagY_M [PF07337], Evalue: 0, Aligned region: 1402..1429
CagY_M [PF07337], Evalue: 0, Aligned region: 1451..1485
TrbI [PF03743], Evalue: 5.8e-36, Aligned region: 1665..1861
Protein Sequence: 1901 a.a.     [Download]
>gi|210134729|ref|YP_002301168.1| cag pathogenicity island protein Y VirB10-like protein [Helicobacter pylori P12]
MNEENDKLETSKKTQQDSPQDLSNEEATEVNHFEDLLKEESSDNHLDNPTEIKTNFDGDKLEETQTQMDS
GGDETSESSNGSLADKLFKKARKLVDNKRPFTQQKNLDEETQELNEEDDQENNEYQEETQTGLIDDETSK
KTQQDSPQDLSNEEATEVNRFEDSLKEESSDQHLDNSAETQTNFDKDKSEEITNDSNDQEIIKGSKKKYI
ISGLVVAVLIVIILFSRSIFHYFMPLEDKSSRFSKDRNLYVNDEIQIRQEYNRLLKERNEKGNMIDKNLF
FNDDPNRTLYNYLNIAEIEDKNPLRAFYECISNGGNYEECLKLIKDKKLQDQMKKTLEAYKDCIKNAKTE
EERIKCLDLIKDENLKKSLLNQQKVQVALDCLKKAKTDEERNECLKLINDPEIREKFRKELGLQKELQVY
KDCIKNAKTEAEKNECLKGLSKEAIERLKQQVLDCLKNAKTDEERNECLKNIPQDLQKELLADMSVKAYK
DCVSKARNEKEKKECEKLLTPEAKKKLEQQVLDCLKNAKTDEERKKCLKDLPKDLQSDILAKESVKAYKD
CVSQAKTEAEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEAEKKECEKLLTPEAKKLLEEAKK
SVKAYLDCVSQAKNEAEKKECEKLLTPEAKKLLEQQALDCLKNAKTEADKKRCVKDLPKDLQKKVLAKES
VKAYLDCVSQAKNEAEKKECEKLLTPEARKLLEEAKESVKAYKDCVSKARNEKEKKECEKLLTPEAKKLL
EEEAKESVKAYLDCVSQAKTEAEKKECEKLLTPEARKLLEEAKESLKAYKDCLSQARNEEERRACEKLLT
PEARKLLEQQALDCLKNAKTDEERKKCLKDLPKDLQSDILAKESVKAYKDCVSQAKTEAEKKECEKLLTP
EAKKLLEEAKKSVKAYLDCVSQAKTEAEKKECEKLLTPEAKKLLEEAKKSVKAYLDCVSQAKNEAEKKEC
EKLLTPEAKKLLEQQALDCLKNAKTEADKKRCVKDLPKDLQKKVLAKESVKAYLDCVSQAKNEAEKKECE
KLLTPEARKLLEEAKESLKAYKDCLSQARNEEERRACEKLLTPEARKLLEQEVKKSVKAYLDCVSRARNE
KEKQECEKLLTPEARKFLAKQVLNCLEKAGNEEERKACLKNLPKDLQENVLAKESLKAYKDCLSQARNEE
ERRACEKLLTPEARKLLEQEVKKSVKAYLDCVSRARNEKEKQECEKLLTPEARKFLAKQVLNCLEKAGNE
EERKACLKNLPKDLQENVLAKESLKAYKDCLSQARNEEERRACEKLLTPEARKLLEQEVKKSVKAYLDCV
SRARNEKEKQECEKLLTPEARKFLAKELQQKDKAIKDCLKNADPNDRAAIMKCLDGLSDEEKLKYLQEAR
EKAVADCLAMAKTDEEKRKCQNLYSDLIQEIQNKRTQSKQNQLSKTERLHQASECLDNLDDPTDQQAIEQ
CLEGLSDSERALILGIKRQADEVDLIYSELRNRKTFDNMAAKGYPLLPMDFKNGGDIATINATNVDADKI
ASDNPIYASIEPDITKQYETEKTIKDKNLEAKLAKALGGNKKDDDKEKSEKSTAKAKAESNKIDKDVAET
AKNISEIALKNKKEKSGDFVDENGNPIDDKKKEEKQDETSPVKQAFIGKSDPTFVLAQYTPIEITLTSKV
DATLTGIVSGVVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTPIMTRLMIVFTKAITPDGVIIPLANAQ
AAGMLGEAGVDGYVNNHFMKRIGFAVIASVVNSFLQTAPIIALDKLIGLGKGRSERTPEFNYALGQAING
SMQSSAQMSNQILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYDVKITNKSVVDEIIKQSTKTLSREH
EEITTSPKGGN
 
Nucleotide Sequence: 5706 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c565669-559964 Helicobacter pylori P12 chromosome, complete genome
ATGAATGAAGAAAACGATAAACTTGAAACTTCTAAAAAAACCCAACAAGATTCACCCCAAGATCTATCTA
ATGAAGAAGCAACAGAAGTCAATCATTTTGAAGATCTTTTAAAAGAAGAAAGCTCAGATAATCATCTTGA
CAACCCCACAGAAATTAAAACCAATTTTGATGGAGACAAGCTAGAAGAAACCCAAACTCAAATGGATTCT
GGTGGTGATGAAACTTCAGAATCTAGCAATGGCAGTCTAGCAGACAAGTTGTTCAAAAAAGCCAGAAAAT
TAGTTGATAATAAAAGACCTTTCACTCAGCAAAAGAATTTAGATGAAGAAACCCAAGAACTGAACGAAGA
AGACGATCAAGAAAATAATGAGTATCAAGAAGAAACTCAAACGGGCTTAATTGATGATGAAACTTCTAAA
AAAACCCAACAAGATTCACCCCAAGATTTATCCAATGAAGAAGCAACAGAAGTCAATCGCTTTGAAGATT
CTTTAAAAGAAGAAAGCTCAGATCAGCATCTTGACAATTCCGCAGAAACTCAAACCAATTTTGATAAAGA
CAAGTCAGAAGAAATAACTAACGACTCTAACGATCAAGAGATTATCAAAGGAAGCAAAAAGAAATACATT
ATTAGTGGTCTTGTAGTCGCTGTTCTTATCGTGATTATCTTATTTTCTAGAAGCATTTTTCACTACTTCA
TGCCTTTGGAAGATAAAAGCTCTCGTTTTAGCAAAGACAGGAATCTTTATGTCAATGATGAAATCCAAAT
AAGGCAAGAGTATAACCGATTGCTGAAAGAACGGAATGAAAAAGGCAATATGATCGATAAGAATCTTTTC
TTCAATGACGATCCCAATAGAACCTTATACAACTATTTAAATATTGCAGAAATTGAGGACAAAAACCCAT
TGAGAGCCTTTTATGAATGCATTAGTAATGGTGGCAACTATGAAGAATGTTTGAAGCTTATCAAAGACAA
AAAACTTCAAGATCAGATGAAAAAGACTCTAGAGGCTTATAAAGACTGCATCAAAAATGCCAAAACTGAA
GAAGAAAGGATCAAGTGTTTAGATTTAATCAAAGATGAAAACCTGAAAAAAAGCTTACTGAACCAACAAA
AAGTTCAAGTGGCGCTAGATTGTTTGAAAAAGGCTAAAACCGATGAAGAACGAAACGAGTGCCTAAAACT
CATAAATGACCCTGAGATTAGAGAGAAATTCCGTAAGGAATTAGGGCTTCAAAAAGAGCTTCAAGTGTAT
AAGGATTGTATCAAAAACGCCAAAACAGAAGCTGAGAAAAACGAATGCTTGAAAGGCTTGTCTAAAGAAG
CTATAGAAAGATTGAAACAACAAGTGCTAGATTGTTTGAAAAACGCTAAAACTGATGAAGAACGAAACGA
GTGCTTGAAAAATATTCCCCAAGACTTGCAAAAAGAACTACTAGCTGATATGAGTGTCAAGGCTTACAAG
GACTGCGTATCAAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTGCTCACGCCTGAAGCGA
AAAAAAAGTTAGAACAACAAGTGCTAGATTGTTTGAAAAACGCTAAAACTGATGAAGAACGAAAAAAATG
TTTGAAAGATCTCCCTAAAGACTTACAAAGCGATATTTTAGCCAAAGAGAGCGTTAAAGCTTATAAAGAC
TGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTGCTCACGCCTGAAGCGAAAA
AACTTTTAGAAGAAGAAGCCAAAGAGAGCGTTAAAGCTTATTTGGATTGCGTATCTCAAGCCAAAACTGA
AGCTGAGAAAAAAGAATGCGAGAAATTGCTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGCTAAAAAA
AGCGTTAAGGCTTACTTAGATTGCGTATCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGCGAGAAAT
TGCTCACGCCTGAAGCGAAAAAACTTTTAGAGCAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGA
AGCTGATAAAAAAAGGTGTGTCAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCCAAAGAGAGC
GTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGCGAGAAATTAC
TCACCCCTGAAGCGAGGAAACTCTTAGAAGAGGCTAAAGAGAGTGTTAAAGCTTATAAAGACTGCGTATC
AAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAAAAATTACTCACGCCTGAAGCGAAAAAACTTTTA
GAAGAAGAAGCCAAAGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAACTGAAGCTGAGA
AAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAGGAAACTTTTAGAAGAAGCTAAAGAGAGTCTTAA
AGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAAGAAAGGAGAGCTTGCGAGAAACTACTCACC
CCTGAAGCGAGGAAACTCTTAGAACAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACTGATGAAGAAC
GAAAAAAATGTTTGAAAGATCTCCCTAAAGACTTACAAAGCGATATTTTAGCCAAAGAGAGCGTTAAAGC
TTATAAAGACTGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTGCTCACGCCT
GAAGCGAAAAAACTTTTAGAAGAAGCTAAAAAAAGCGTTAAAGCTTATTTGGATTGCGTATCTCAAGCCA
AAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTGCTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGC
TAAAAAAAGCGTTAAGGCTTACTTAGATTGCGTATCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGC
GAGAAATTGCTCACGCCTGAAGCGAAAAAACTTTTAGAGCAACAAGCGCTAGATTGTTTGAAAAACGCTA
AAACCGAAGCTGATAAAAAAAGGTGTGTCAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCCAA
AGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGCGAA
AAATTACTCACCCCTGAAGCGAGGAAACTCTTAGAAGAGGCTAAAGAGAGTCTTAAAGCTTATAAAGACT
GCCTCTCTCAAGCTAGAAATGAAGAAGAAAGGAGAGCTTGCGAGAAATTGCTCACCCCTGAAGCGAGGAA
ACTCTTAGAGCAAGAAGTTAAGAAGAGCGTTAAGGCTTATTTGGACTGCGTATCAAGAGCTAGGAATGAA
AAAGAGAAACAAGAATGCGAGAAATTGCTCACCCCTGAAGCAAGAAAATTTTTAGCGAAGCAAGTGCTAA
ATTGTTTGGAAAAAGCTGGAAATGAAGAAGAAAGAAAAGCATGTCTTAAAAATCTCCCTAAAGACTTACA
GGAAAATGTTTTAGCTAAAGAGAGTCTTAAAGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAA
GAAAGGAGAGCTTGCGAGAAACTACTCACCCCTGAAGCGAGAAAACTCTTAGAGCAAGAAGTTAAGAAGA
GCGTTAAGGCTTATTTAGATTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATT
ACTCACGCCTGAAGCGAGAAAATTCTTAGCGAAGCAAGTGCTAAATTGTTTGGAAAAAGCTGGAAATGAA
GAAGAAAGAAAAGCATGTCTTAAAAATCTCCCTAAAGACTTACAGGAAAATGTTTTAGCTAAAGAGAGTC
TTAAAGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAAGAAAGGAGAGCTTGCGAGAAACTACT
CACCCCTGAAGCGAGAAAACTCTTAGAGCAAGAAGTTAAGAAGAGCGTTAAGGCTTATTTAGATTGCGTT
TCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGAAAATTCT
TAGCGAAAGAACTCCAACAAAAAGATAAAGCGATCAAAGATTGCTTGAAAAATGCCGATCCTAACGACAG
AGCGGCTATTATGAAGTGTTTGGATGGTTTGAGCGATGAAGAGAAGCTCAAATACCTGCAAGAAGCTAGA
GAAAAGGCTGTTGCGGATTGTTTGGCTATGGCTAAAACCGATGAAGAAAAAAGGAAATGCCAAAACCTTT
ATAGCGATTTGATCCAAGAAATCCAAAATAAAAGGACACAAAGCAAACAAAATCAATTGAGCAAAACAGA
AAGATTGCATCAAGCAAGCGAGTGCTTGGATAACTTAGATGACCCTACCGATCAACAAGCCATAGAGCAA
TGTTTAGAGGGCTTGAGCGATAGTGAAAGGGCACTAATTCTAGGAATCAAACGACAAGCTGATGAAGTGG
ATCTGATTTATAGCGAACTAAGAAACCGCAAAACCTTTGATAACATGGCGGCTAAAGGTTATCCATTGTT
ACCAATGGATTTCAAAAATGGTGGCGATATTGCCACTATTAACGCCACTAATGTTGATGCGGACAAAATA
GCTAGCGATAATCCTATTTATGCTTCCATAGAGCCTGATATTACCAAGCAATACGAAACAGAAAAAACCA
TTAAGGATAAGAATTTAGAAGCTAAATTGGCTAAGGCTTTAGGTGGTAATAAAAAAGATGACGATAAAGA
AAAAAGTGAAAAATCCACAGCAAAAGCTAAAGCAGAAAGCAATAAGATAGACAAAGATGTCGCAGAAACT
GCCAAGAATATCAGTGAAATCGCTCTTAAGAACAAAAAAGAAAAGAGTGGGGATTTTGTAGATGAAAATG
GTAATCCCATTGATGACAAAAAGAAAGAAGAAAAACAAGATGAAACAAGCCCTGTCAAACAGGCCTTTAT
AGGCAAGAGTGATCCCACATTTGTTTTAGCGCAATACACCCCCATTGAAATCACTCTGACTTCTAAAGTA
GATGCCACTCTCACGGGTATAGTGAGTGGGGTTGTAGCCAAAGATGTATGGAACATGAACGGTACTATGA
TCTTATTAGACAAAGGCACTAAGGTGTATGGGAATTATCAAAGCGTGAAAGGTGGCACGCCTATTATGAC
ACGCTTAATGATAGTCTTCACTAAAGCCATTACGCCTGATGGTGTGATTATACCTCTAGCAAACGCTCAA
GCAGCAGGCATGCTGGGTGAAGCAGGGGTAGATGGCTATGTGAATAATCACTTTATGAAGCGCATAGGCT
TTGCTGTGATAGCAAGCGTGGTTAATAGCTTCTTGCAAACTGCGCCTATCATAGCTCTAGATAAACTCAT
AGGCCTTGGCAAAGGTAGAAGTGAAAGGACACCTGAATTTAATTACGCTTTGGGTCAAGCTATCAATGGC
AGCATGCAAAGTTCAGCTCAGATGTCTAATCAAATTCTAGGGCAACTGATGAATATCCCCCCAAGTTTTT
ACAAAAATGAGGGCGATAGTATTAAGATTCTCACAATGGACGATATTGATTTTAGCGGTGTGTATGATGT
TAAAATTACTAACAAATCTGTGGTAGATGAAATTATCAAACAAAGCACCAAAACTTTGTCTAGAGAACAT
GAAGAAATCACCACAAGCCCCAAAGGTGGCAATTAA
 Primer design