SecReT4
Protein ID: 210134730
T4SS name [ID]Cag [35]
Gene symbolcagX
Locus tagHPP12_0535
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]565684..567252 [-]
Productcag pathogenicity island protein X VirB9-like protein
Component typeCagX
UniProt IDB6JLB1
KEGG IDhpp:HPP12_0535
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.5e-38, Aligned region: 55..171
CagX [PF03524], Evalue: 2.5e-38, Aligned region: 259..347
CagX [PF03524], Evalue: 2.5e-38, Aligned region: 368..490
Protein Sequence: 522 a.a.     [Download]
>gi|210134730|ref|YP_002301169.1| cag pathogenicity island protein X VirB9-like protein [Helicobacter pylori P12]
MEKAFFKKIVGCFCLGYLFLSSVIEAAAPDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLE
KDETISYITTGFNKGWSIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKE
LEEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSEFIKQQRENE
LDQMERLEDMQEQAQANALKQIEELNKKQAEETIKQRAKDKISIKTDKPQKSPEDNSIELSPSDSAWRTN
LVVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQRELIKQENLNTTAY
INRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIF
DDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNLGLRWYRVNEIAEKFKLIKDKALVTVINK
GYGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c567252-565684 Helicobacter pylori P12 chromosome, complete genome
ATGGAGAAGGCATTTTTTAAAAAAATTGTTGGCTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGTAA
TAGAAGCAGCAGCACCTGACATTAAAAATTTTAATCGTGGTAGGGTGAAAGTGGTGAATAAGAAGATTGC
TTATTTGGGAGATGAAAAACCTATTACGATTTGGACTTCATTAGACAATGTTACCGTGATCCAACTTGAA
AAAGATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAGTATTGTGCCTAATTCTAATC
ATATATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCCCT
AATGACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCGCCTGACCCTAAAGAA
TTAGAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAGGCGCAAAAGGCGCAAAAAG
ATAAAAGAGAAAAAAGAAAGGAGGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTAT
GAGTAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTTATCAAGCAACAACGAGAAAATGAA
TTAGACCAAATGGAACGACTAGAGGACATGCAAGAACAGGCTCAAGCTAATGCGCTCAAACAAATTGAAG
AACTCAACAAGAAACAAGCTGAAGAGACAATCAAGCAAAGAGCCAAAGATAAAATCAGTATTAAGACAGA
TAAGCCTCAAAAAAGCCCTGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGAACCAAT
CTTGTTGTGCGGACCAATAAGGCCTTGTATCAATTCATTTTGAGGATAGCTCAAAAAGATAATTTTGCTT
CGGCGTATCTAACAGTCAAATTGGAATACCCACAAAGACACGAAGTTTCTAGCGTTATTGAAGAGGAGCT
AAAAAAGAGAGAAGAAGCAAAGAGACAGAGAGAATTGATCAAGCAAGAAAATCTTAACACCACAGCCTAC
ATCAATAGAGTGATGATGGCGAGCAATGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAACAAA
AAATTATCTTAGATCAAGCAAAGGCGCTAGAGACTCAATATGTGCATAATGCATTAAAAAGAAACCCTGT
GCCTAGAAACTACAATTACTACCAAGCGCCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTT
GATGATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTCAAC
CTGATGGGAAATTGAGCATGACTGATGCCGCTATTGATCCTAACATGACCAATTTAGGATTGAGATGGTA
TAGAGTTAATGAAATTGCAGAAAAATTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTAATAAATAAA
GGCTATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGCGTGATTA
AAAAGCTCCCTCTTGTCAGAGATAAATAA
 Primer design