SecReT4
Protein ID: 210134732
T4SS name [ID]Cag [35]
Gene symbolcagV
Locus tagHPP12_0537
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]568917..569675 [-]
Productcag pathogenicity island protein V
Component typeCagV
UniProt IDB6JLB3
KEGG IDhpp:HPP12_0537
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.8e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|210134732|ref|YP_002301171.1| cag pathogenicity island protein V [Helicobacter pylori P12]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNVAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQITIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALKQ
 
Nucleotide Sequence: 759 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c569675-568917 Helicobacter pylori P12 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAGGAAGTCTTGATTGATGAAAATTTGGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCAAAACTCAATAAGGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGCACTCAATGT
CGCCGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAAAAAACAGATATATTTGTTTATGGCATTGAT
CGATACACAGGAGAATTTAAAATCGTCAAACGCTCCGATGCTAGGCAAATCGTCAATTCTGAAGCTGTTG
TGGATAGTGCAACTTCAAAATTTGTATCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAA
GGATCAATTAATGCAGTATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTAGATAAAGTCCGAGCAGAAGCTATCATTAGCTCTAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACACCTGATACAATGGAAAATTATGA
ATATATCACTAAAAAACAAATAACTATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAATCCTTTTGGCTTTAAAGTGTTTGACATTCAAATCACGGATTTACAAAACGAACAGACGGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAAACAATAA
 Primer design