SecReT4
Protein ID: 210134734
T4SS name [ID]Cag [35]
Gene symbolcagT
Locus tagHPP12_0539
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]570733..571575 [+]
Productcag pathogenicity island protein T
Component typeCagT
UniProt IDB6JLB5
KEGG IDhpp:HPP12_0539
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|210134734|ref|YP_002301173.1| cag pathogenicity island protein T [Helicobacter pylori P12]
MKLRASVLIGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNNKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAKDEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|210134201|ref|NC_011498.1|:570733-571575 Helicobacter pylori P12 chromosome, complete genome
ATGAAACTGAGAGCAAGTGTTTTAATCGGTGCGACAATTCTGTGCTTAATTTTAAGCGCGTGCAGTAATT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAGAAGTA
TAGTGAGATACCCTTAAATGACAAACTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGACTATTTGTTGGATAATAAACAAGTTGTACTAACTTTCAAACTTGTTCACCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATCCTTCAATACAAGAATTACTTCCAAGCTAACGGGGCAAGATCTGA
CATTGATTTTTACTTGCAGCCTACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTACAATGAT
AATCCTAACAACAAAGAAAAACCGCAGACCTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAAACTCTCTTACAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACATTGAGTAATCGTGCAGGTTATCAAATGAGAC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAAAGATGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTGCGCAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design