SecReT4
Protein ID: 210134739
T4SS name [ID]Cag [35]
Gene symbolcagM
Locus tagHPP12_0544
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]574409..575539 [+]
Productcag pathogenicity island protein M
Component typeCagM
UniProt IDB6JLC0
KEGG IDhpp:HPP12_0544
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|210134739|ref|YP_002301178.1| cag pathogenicity island protein M [Helicobacter pylori P12]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLIFRKQKIKE
LMDHRAKVLLDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNPLYKKLLPNPYAYVLNQETFT
QEDKERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNVSN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVVSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|210134201|ref|NC_011498.1|:574409-575539 Helicobacter pylori P12 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCGTTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAATTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAAGTGGCTGCAAAAGAAGACGCTCTTAAGGCTCG
CAAGAAGCTCTTAAACAATACGCATGATTTCTTAGAAGACTTGATTTTTAGAAAACAAAAAATCAAAGAG
CTTATGGATCATAGAGCTAAAGTCCTTTTAGACTTAGAGAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGTGATCTAGAGCAAGCCTTAAA
AGATAACCCTCTCTATAAGAAACTTCTTCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACG
CAAGAGGATAAGGAGCGTTTGAGTTATTACTACCCTCAGGTGAAAACAAGCAGTATTTTTAAAAAAACTA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTTTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAATGTTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTACAGCTTGAAAGAAACAAGTTTGACTCCA
AAGCAAAAGATATTGCTCAAAAAGCTACTAACACGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATTAATGAGAAATACTTAAGGGGCTATGAGGCTTTTTCTAACTTGTTGAAGAATGTC
AAAGATGATGTGGAATTGAATACTCTGACTAAAAACTTTACCAATCAAAAATTGAGTTTCGCTCAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATTTTCGTAGATAGCGATCCTATGATGAGCGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGGTTTCTGCATACCGAAACAATGTTGCCAAGAATAATC
CCTTTGAATAG
 Primer design