SecReT4
Protein ID: 210134740
T4SS name [ID]Cag [35]
Gene symbolcagN
Locus tagHPP12_0545
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]575554..576474 [+]
Productcag pathogenicity island protein N
Component typeCagN
UniProt IDB6JLC1
KEGG IDhpp:HPP12_0545
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|210134740|ref|YP_002301179.1| cag pathogenicity island protein N [Helicobacter pylori P12]
MKSIFKKLGSVALYSLVIYGGLNAINTALLPSEYKELAALGFKKIKTLHQRHGDEEITEEEKKFATNALR
EKLRNDRARAEQIQKNIEAFEKKNNSSVQKKAAKHKGLQELNEINATPLNDNPNSNSSAETKSNKDDNFD
EMINKVNEAFVKPAAPLVPNEWRTPEIEIIINECIISSNDYDGLRKCLIKGIKDQKILAPLLEKIQEIET
ENNKFSRQHLSGLKLALNNSNNRTFLIASCTICEKRKKEMEQENNYQDTTNASKFGTTDTKENEAKDATF
SNNRSKSELPNSVINQIEQSIAHEKK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|210134201|ref|NC_011498.1|:575554-576474 Helicobacter pylori P12 chromosome, complete genome
TTGAAAAGCATCTTCAAAAAACTAGGTTCTGTCGCTCTTTATTCTTTAGTTATTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTGCCGAGTGAATACAAAGAATTAGCGGCTTTGGGCTTTAAAAAAATCAAAAC
ACTCCATCAAAGACATGGCGACGAAGAAATTACAGAAGAGGAAAAAAAATTCGCCACTAACGCTTTGAGA
GAAAAATTACGAAATGATAGGGCAAGAGCAGAGCAAATTCAAAAGAATATTGAAGCGTTTGAAAAAAAGA
ACAACTCTTCTGTTCAAAAAAAAGCGGCTAAGCACAAAGGATTACAAGAATTAAACGAAATTAACGCTAC
CCCTTTGAATGACAACCCTAATAGCAATTCTTCCGCTGAAACCAAATCTAATAAAGATGATAACTTTGAT
GAGATGATCAATAAGGTGAATGAAGCTTTTGTAAAACCTGCTGCTCCGCTTGTGCCTAATGAGTGGAGAA
CACCTGAAATTGAAATCATTATCAATGAGTGTATTATTTCAAGCAACGATTATGATGGGTTAAGAAAGTG
TTTGATCAAAGGCATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATCCAAGAAATAGAGACA
GAAAATAACAAGTTTTCTAGACAACACTTGAGTGGTTTAAAACTCGCTCTTAATAACAGCAACAATAGAA
CCTTTCTTATAGCTTCATGCACTATTTGTGAGAAGAGAAAAAAAGAAATGGAGCAAGAAAATAACTACCA
AGATACTACAAATGCAAGCAAGTTTGGCACTACTGATACAAAAGAAAATGAAGCAAAAGATGCAACATTC
TCAAACAATCGCTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCGCTCATG
AAAAAAAATAG
 Primer design