SecReT4
Protein ID: 210134741
T4SS name [ID]Cag [35]
Gene symbolcagL
Locus tagHPP12_0546
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]576555..577268 [-]
Productcag pathogenicity island protein L
Component typeCagL
UniProt IDB6JLC2
KEGG IDhpp:HPP12_0546
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|210134741|ref|YP_002301180.1| cag pathogenicity island protein L [Helicobacter pylori P12]
MKTLVKNTISSFLLLSVLMAEDITSGLKQLDSTYQETNQQVLKNLDEIFSTTSPSANDKMGEEDALNIKK
AAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYIKINPLDQKTAEQQCGISDKILVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAQNKVFLNYLEE
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c577268-576555 Helicobacter pylori P12 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCATATCTTCTTTTTTGCTCTTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGCTTAAAGCAACTGGATAGCACCTACCAAGAGACCAACCAACAAGTGCTCAAAAACTTAGATGA
AATTTTTTCAACCACTAGCCCTAGCGCTAATGATAAAATGGGTGAAGAAGATGCTCTAAACATCAAAAAA
GCGGCCATTGCTTTGAGAGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTTAAGACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATAAAAATCAA
TCCCTTAGACCAAAAGACTGCTGAACAGCAATGCGGAATATCCGATAAAATTTTAGTTCTTTATTGTGAG
GGGAAGCTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCCCTAAAGGCGTATC
AGAGCAACATTGGAGGTACAGCTTCTTTAATCACTGCTTCACAGACGCTTGTAGAAAGCCTAAAGAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCAAAACAAGGTCTTTTTAAATTATTTAGAGGAG
TTGGACGCATTAGAAAGATCCCTAGAACAAAGTAAGCGACAATACTTACAAGAAAGGCAATCGAGTAAGA
TCATTGTCAAATGA
 Primer design