SecReT4
Protein ID: 210134744
T4SS name [ID]Cag [35]
Gene symbolcagG
Locus tagHPP12_0549
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]579550..579978 [-]
Productcag pathogenicity island protein G
Component typeCagG
UniProt IDB6JLC5
KEGG IDhpp:HPP12_0549
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|210134744|ref|YP_002301183.1| cag pathogenicity island protein G [Helicobacter pylori P12]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAIL
NDYNDKNVNIKFDDISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYSDSSFLPPIL
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c579978-579550 Helicobacter pylori P12 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CGCTTAACGCTGACCAAAACACTGACATAAAAGATATTAGTCCTGAAGATATGGCACTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAACTAAAAATAGAGATCCCTAAAGAAACCCTAGAGCAAAAAGTGGCCATACTC
AATGACTATAATGATAAAAATGTTAATATCAAATTTGACGACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGCATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
TCCAAACAATCCTTTCATGTATGGCTATGCGCCAACATACTCAGATTCATCGTTTTTACCACCGATCTTA
GGGTATTAA
 Primer design