SecReT4
Protein ID: 210134747
T4SS name [ID]Cag [35]
Gene symbolcagD
Locus tagHPP12_0552
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]583805..584428 [-]
Productcag pathogenicity island protein D
Component typeCagD
UniProt IDB6JLC8
KEGG IDhpp:HPP12_0552
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 207 a.a.     [Download]
>gi|210134747|ref|YP_002301186.1| cag pathogenicity island protein D [Helicobacter pylori P12]
MINNNSNKKLRGFFLKVLLSLVVFSSYGSANDDNQAKKEALEKEKNTPNGLVYTNLDFDSFKATIKNLKD
KKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPVIEKIFDEKGKEMGLNVELQINPEVKDFFTFK
SISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTVESLKKIFYTITCEAVYL
 
Nucleotide Sequence: 624 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c584428-583805 Helicobacter pylori P12 chromosome, complete genome
TTGATCAACAATAATAGTAATAAAAAATTAAGAGGCTTTTTTTTGAAAGTTCTCTTAAGTCTCGTTGTTT
TCAGTTCGTATGGGTCAGCAAATGACGATAATCAAGCCAAAAAAGAAGCGCTAGAAAAAGAAAAAAACAC
TCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTTAAAGCGACTATCAAAAATTTGAAAGAC
AAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAGATGAAGTTTTTGATTTCGTGATTGTCA
ATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCCAGTTATTGAAAAAATCTTTGATGAAAA
GGGTAAAGAAATGGGATTGAATGTAGAATTACAGATCAATCCTGAAGTGAAAGACTTTTTTACTTTCAAA
AGCATCAGCACGACCAACAAACAACGCTGCTTTCTGTCATTGCGCGGAGAAACAAGAGAAATTCTATGCG
ATGATAAGCTATATAATGTTTTATTGGCCGTATTCAATTCTTATGATCCTAATGATCTTTTGAAACATAT
TAGCACCGTAGAGTCTCTCAAAAAAATCTTTTATACGATTACATGTGAAGCGGTATATCTATAA
 Primer design