SecReT4
Protein ID: 210135519
T4SS name [ID]VirB [608]
Gene symbolvirB7-2
Locus tagHPP12_1327
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]1399703..1399843 [+]
ProductVirB7 type IV secretion protein
Component typeVirB7
UniProt IDB6JNK0
KEGG IDhpp:HPP12_1327
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 46 a.a.     [Download]
>gi|210135519|ref|YP_002301958.1| VirB7 type IV secretion protein [Helicobacter pylori P12]
MKNIMRLVFVIVAMFLCACSEKFIEMKKSPCALKDLNNSFLRGTHV
 
Nucleotide Sequence: 141 bp     [Download]
>gi|210134201|ref|NC_011498.1|:1399703-1399843 Helicobacter pylori P12 chromosome, complete genome
ATGAAAAACATCATGCGTTTAGTTTTTGTGATAGTGGCTATGTTTCTATGTGCATGCTCAGAGAAATTCA
TAGAAATGAAAAAATCCCCTTGTGCGTTAAAGGACTTAAACAACTCTTTTTTAAGGGGGACACATGTCTA
A
 Primer design