SecReT4
Protein ID: 210135520
T4SS name [ID]VirB [608]
Gene symbolvirB8-2
Locus tagHPP12_1328
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]1399836..1400972 [+]
ProductVirB8 type IV secretion protein
Component typeVirB8
UniProt IDB6JNK1
KEGG IDhpp:HPP12_1328
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-24, Aligned region: 134..333
Protein Sequence: 378 a.a.     [Download]
>gi|210135520|ref|YP_002301959.1| VirB8 type IV secretion protein [Helicobacter pylori P12]
MSNLQELREHLKELENSFEIGSFTKENIKEYAKCFFMSLSMFLEEQEKNQQEEFLEQDTKENQEELIKSI
QTSIAKNQELEKISFEKWENKIQERVLPKLKRIVTHKLQESITSSINTQLESFKKDELDLSSVFEIQRKN
TQIAYRLAIGGLIGIIALSIAIFIMMPLKENTPYFIDFANSDKHFAVVQRADTKVDYGEAFLRNLVGSYI
TARETINHIDDKIRLNETIREQSSEEVWKTLEQLVSGKGSIYSNSNMDREIKIINISIYKQGKQQNIAVA
DIVAKVFDKGYLISEKRYRVSLIYHFKPLIQFDYSSMPKNPTGFIVDKYSLSEIASIKALDKTYKKVERP
HSKIEYKKQNPTNPQNNPANIPNNKEEQ
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|210134201|ref|NC_011498.1|:1399836-1400972 Helicobacter pylori P12 chromosome, complete genome
ATGTCTAATTTGCAAGAACTTAGAGAGCATTTAAAAGAATTAGAAAATTCCTTTGAAATAGGCTCTTTTA
CTAAAGAAAATATTAAAGAATACGCTAAATGCTTTTTTATGAGTTTAAGCATGTTTTTAGAAGAACAAGA
AAAAAACCAACAAGAAGAGTTTTTAGAACAAGATACCAAAGAAAATCAAGAAGAGCTCATTAAAAGCATT
CAAACAAGCATTGCTAAAAACCAAGAGTTAGAAAAAATCTCTTTTGAAAAATGGGAGAATAAAATTCAAG
AAAGGGTTTTGCCTAAGTTAAAACGCATTGTTACGCATAAGTTGCAAGAAAGTATCACATCTAGCATAAA
CACGCAATTAGAGAGTTTTAAAAAAGATGAGTTAGATTTATCTAGCGTGTTTGAAATCCAAAGAAAGAAC
ACTCAAATAGCGTATAGATTAGCTATAGGGGGGCTTATAGGTATCATTGCTTTAAGTATAGCCATTTTTA
TTATGATGCCCTTAAAAGAAAACACGCCTTATTTTATAGACTTTGCTAATAGCGATAAGCATTTTGCTGT
GGTGCAAAGAGCGGATACCAAAGTAGATTATGGCGAGGCATTTTTAAGAAATCTAGTCGGCTCTTACATT
ACAGCTAGAGAAACTATCAATCATATTGATGACAAAATCCGCTTGAATGAAACCATAAGAGAGCAAAGCT
CTGAAGAAGTGTGGAAAACTTTAGAGCAGTTAGTATCAGGCAAGGGCAGTATCTATTCTAACTCTAATAT
GGATAGAGAAATTAAAATCATCAATATTTCTATCTATAAGCAAGGCAAACAACAAAATATCGCTGTAGCA
GATATTGTAGCTAAGGTCTTTGATAAAGGCTATTTAATCTCTGAAAAACGCTACAGAGTGTCTTTAATCT
ATCACTTCAAACCCCTTATTCAATTTGATTATAGTTCTATGCCTAAAAACCCTACAGGCTTTATCGTAGA
TAAATATTCCTTGAGTGAAATCGCAAGCATTAAAGCCCTAGATAAGACTTATAAAAAAGTGGAAAGACCC
CATTCTAAAATTGAATACAAAAAACAAAATCCAACTAACCCCCAAAACAACCCAGCTAATATACCTAATA
ATAAGGAAGAACAATGA
 Primer design