SecReT4
Protein ID: 210135527
T4SS name [ID]VirB [608]
Gene symbolvirB11-3
Locus tagHPP12_1335
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]1407327..1408271 [+]
ProductVirB11 type IV secretion ATPase
Component typeVirB11
UniProt IDB6JNK8
KEGG IDhpp:HPP12_1335
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.7e-45, Aligned region: 24..291
Protein Sequence: 314 a.a.     [Download]
>gi|210135527|ref|YP_002301966.1| VirB11 type IV secretion ATPase [Helicobacter pylori P12]
MDLDKLKDYRALRNAILRLLPYLDSGITELIMNKEKEIWLYKLNGVREKVFDENLDKAFILGFGEQLASF
RDLFFNANYPTLNTSIPTSRYRVSMNHFAISADNELSLNIRVPSDKKFDLKAFKLSSICQYDYEYLQNLM
IEGKNLLISGGTGSGKTSFLNALIEFIPKHTRIVSVEDSEELDLRAFENHKSLLVDKTESSKFTYENALN
MAMRMSPDRLMVGEIDTRNSMLFLRFGNTGHKGMVSTLHADSVHGVIEAIALNLQMNKSGLDVNVVKKFF
KSSVDIVVQIVLDKATNTRYIQEILPAKDLRDSL
 
Nucleotide Sequence: 945 bp     [Download]
>gi|210134201|ref|NC_011498.1|:1407327-1408271 Helicobacter pylori P12 chromosome, complete genome
ATGGACTTAGACAAACTCAAAGATTATAGGGCTTTAAGAAACGCTATTTTAAGGCTATTGCCTTATTTAG
ATAGCGGTATTACAGAGCTAATAATGAATAAAGAAAAAGAAATTTGGCTCTATAAGCTTAATGGAGTAAG
GGAAAAAGTCTTTGATGAAAATTTAGACAAAGCCTTTATTCTGGGGTTTGGGGAACAATTAGCGAGTTTT
AGAGATTTGTTTTTTAATGCTAATTACCCCACCCTTAATACTTCCATTCCTACTTCTAGATACAGAGTGA
GCATGAACCACTTTGCTATTAGTGCGGATAATGAATTGAGTTTGAATATTAGAGTGCCAAGTGATAAAAA
GTTTGATTTAAAAGCTTTCAAGCTTTCTAGTATCTGTCAATACGATTATGAGTATCTACAAAACTTAATG
ATTGAGGGCAAAAACTTACTCATTAGTGGAGGCACAGGCAGTGGAAAAACGAGTTTTTTAAACGCTCTAA
TTGAGTTTATCCCCAAACACACACGAATAGTAAGCGTTGAAGATAGCGAAGAATTAGATTTAAGAGCGTT
TGAAAATCATAAATCCTTGTTAGTGGATAAAACTGAAAGCTCTAAATTTACCTATGAAAACGCCTTGAAT
ATGGCAATGAGAATGTCTCCTGATAGGCTTATGGTAGGCGAGATTGACACACGAAATTCCATGCTCTTTT
TAAGATTTGGAAACACTGGGCATAAAGGCATGGTTTCTACTTTACATGCAGATAGTGTGCATGGGGTTAT
AGAGGCGATTGCTTTAAATTTACAAATGAATAAAAGTGGTTTAGATGTCAATGTAGTAAAAAAATTCTTT
AAAAGCAGTGTGGATATTGTCGTTCAAATTGTATTAGATAAAGCCACTAACACCAGATACATTCAAGAAA
TCTTACCAGCAAAAGATTTAAGAGATAGCCTATGA
 Primer design