SecReT4
Protein ID: 210135529
T4SS name [ID]VirB [608]
Gene symbolvirD4-2
Locus tagHPP12_1337
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]1408783..1411026 [+]
ProductVirD4 coupling protein
Component typeVirD4
UniProt IDB6JNL0
KEGG IDhpp:HPP12_1337
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.9e-65, Aligned region: 95..612
TraG-D_C [PF12696], Evalue: 1.8e-22, Aligned region: 458..578
TrwB_AAD_bind [PF10412], Evalue: 4.7e-20, Aligned region: 420..594
AAA_10 [PF12846], Evalue: 2.1e-05, Aligned region: 148..532
Protein Sequence: 747 a.a.     [Download]
>gi|210135529|ref|YP_002301968.1| VirD4 coupling protein [Helicobacter pylori P12]
MKMQFVKAFCVLFSILLIPLFFILANYYTFDALKSLRQAYFFSQSVFVGLYHGASIFDLKFEVYLTMLIS
LMPFVATIYINFPKTTETSHGYARWANVKDIECFKIFSKEGFCKVVHRLGVQFDNGFILGKFGFPKLRNV
CYDKPLGAMIVAPPGAGKTACVALPNLLTLPNSCIITDIKGELRDKTAGYRQKFLNNRILIFNPYGDDNT
CYFNPFDKRIVEKMTFAEQLRHVKAVGDGIFVDEEDHWVSKAKELFVFFALLQVVTKGHSSFYDVSIAPA
NDYAPLIHPKSPYYKQLYQHDKKTGEVILDPQTNAPMKNPQANVLKLFLNQVADQKYIDMNDEKNYDPRE
PEPPYGTKGALDEIIRTDARSWANTPDDEFGSIMSSFKRFMYVYKDPKVREATSKMSFDYEELRTGNISI
YIVIAQIDIGTLSSLVRAFLESIAKNLMVKESSKPEERIFIIADEFVRFGKLPFLLEMPALCRSYNVVPL
FITQDYAMIRKYYSDDDLKILKGVVHYNIVFKMNSAEDAEIVSKEVGEFTRQSKNYSTEKSQLVFGGSSS
YSHEGRNLLTAQDIMNINSDEVIVIVTGAKATPLKLKANYWFKDKELLKRANLPIDLEVERQRVEEPIQP
TTEIETTPNQNKADLGPSNKGEKVENESNERNTNENNPTTPQELENSNLKESEKDDESTITLENANENIE
QGNHNEIDEILKKPLSEISMEEKRALFKKMQQGDEESEQEVTQSTQS
 
Nucleotide Sequence: 2244 bp     [Download]
>gi|210134201|ref|NC_011498.1|:1408783-1411026 Helicobacter pylori P12 chromosome, complete genome
ATGAAAATGCAATTTGTGAAGGCTTTTTGCGTGCTTTTCAGCATTTTACTTATCCCCTTATTTTTTATCT
TGGCAAATTATTACACTTTTGATGCCTTAAAGTCGTTGAGACAGGCTTATTTCTTTTCTCAAAGCGTGTT
TGTAGGGCTTTATCATGGGGCAAGCATCTTTGATTTAAAATTTGAAGTCTATCTTACTATGCTAATCTCT
TTAATGCCCTTTGTGGCTACGATTTATATCAATTTCCCAAAAACCACAGAAACTTCGCATGGCTATGCGA
GATGGGCTAATGTTAAAGATATAGAATGCTTTAAAATTTTTAGCAAAGAGGGCTTTTGTAAAGTGGTGCA
TAGATTAGGGGTGCAATTTGATAATGGCTTTATTCTAGGTAAATTTGGTTTTCCAAAGCTTAGAAATGTG
TGCTATGACAAGCCCTTAGGAGCGATGATTGTTGCACCCCCTGGTGCTGGAAAAACTGCATGTGTGGCTT
TGCCAAATTTATTGACTTTGCCTAATAGCTGTATCATCACTGATATTAAAGGCGAACTAAGAGATAAGAC
CGCAGGTTATAGACAAAAATTCTTAAACAATAGAATTTTAATTTTTAATCCTTATGGTGATGATAACACT
TGCTATTTCAATCCTTTTGATAAAAGGATTGTTGAAAAGATGACCTTTGCGGAGCAATTAAGGCATGTTA
AAGCAGTAGGCGATGGTATTTTTGTAGATGAAGAAGACCATTGGGTATCTAAAGCTAAAGAGCTTTTTGT
CTTTTTTGCTCTTTTACAAGTAGTAACCAAAGGGCATAGCTCTTTTTATGATGTCTCTATCGCACCAGCT
AATGATTATGCCCCCTTAATACACCCTAAAAGCCCTTATTACAAGCAACTTTACCAACACGATAAAAAGA
CAGGCGAAGTTATCTTAGACCCACAAACTAACGCCCCTATGAAAAATCCCCAAGCTAATGTTTTAAAACT
CTTTTTAAATCAAGTGGCTGACCAAAAATACATAGATATGAATGATGAAAAAAACTATGACCCAAGAGAA
CCTGAACCCCCTTATGGAACAAAAGGGGCGTTAGATGAGATTATAAGGACAGATGCTAGGAGTTGGGCAA
ACACTCCTGATGATGAATTTGGGAGCATTATGTCTTCTTTTAAGCGTTTTATGTATGTCTATAAAGACCC
AAAAGTGCGTGAAGCTACTTCTAAAATGAGCTTTGATTATGAAGAATTAAGAACGGGCAATATCAGTATT
TACATTGTAATCGCTCAAATTGATATAGGCACACTTTCTTCTTTAGTAAGAGCCTTTTTAGAGAGTATTG
CTAAAAACCTTATGGTCAAAGAAAGCTCTAAACCTGAAGAGCGTATTTTTATCATTGCTGATGAATTTGT
TAGATTTGGTAAGTTGCCTTTCTTGTTAGAAATGCCAGCACTTTGTCGCTCTTATAATGTTGTCCCCTTA
TTCATCACGCAAGATTATGCGATGATTAGAAAATACTATAGCGATGATGATTTGAAAATCTTAAAAGGCG
TGGTGCATTATAACATTGTCTTTAAGATGAATAGTGCTGAAGATGCTGAGATTGTCTCTAAGGAAGTGGG
CGAATTTACAAGACAATCTAAAAATTATTCTACCGAAAAAAGTCAATTGGTCTTTGGAGGTAGCTCTTCT
TATAGCCATGAGGGTAGAAACTTACTCACAGCCCAAGATATTATGAATATCAATTCAGATGAAGTCATTG
TTATTGTTACAGGGGCTAAAGCTACCCCCTTAAAACTCAAAGCTAATTATTGGTTCAAAGATAAAGAACT
TTTAAAAAGAGCTAATTTGCCTATTGATTTAGAAGTAGAGAGACAAAGAGTTGAAGAGCCTATACAACCC
ACTACAGAGATTGAAACAACCCCTAATCAAAACAAAGCTGACTTAGGACCAAGTAATAAGGGGGAAAAAG
TAGAGAATGAGAGCAATGAGAGAAACACTAACGAGAATAATCCCACTACACCACAAGAGCTTGAAAATTC
AAACTTAAAAGAAAGCGAGAAAGACGATGAAAGTACCATTACCTTAGAAAATGCTAATGAAAATATAGAG
CAAGGAAATCACAATGAAATTGATGAGATTTTAAAAAAGCCACTGAGTGAAATCAGTATGGAAGAGAAAA
GAGCCTTGTTTAAGAAAATGCAACAAGGCGATGAAGAAAGCGAACAAGAAGTTACACAAAGCACCCAAAG
TTAA
 Primer design