SecReT4
Protein ID: 21231913
T4SS name [ID]VirB [389]
Gene symbolvirB11
Locus tagXCC2478
StrainXanthomonas campestris pv. campestris str. ATCC 33913
Repliconchromosome [GenBank: NC_003902] [Browse all T4SS(s) in this replicon]
Location [Strand]2947569..2948627 [-]
ProductVirB11 protein
Component typeVirB11
UniProt IDQ8P7X7
KEGG IDxcc:XCC2478
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.9e-64, Aligned region: 34..331
FtsK_SpoIIIE [PF01580], Evalue: 3.1e-05, Aligned region: 168..201
Protein Sequence: 352 a.a.     [Download]
>gi|21231913|ref|NP_637830.1| VirB11 protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
MSATTAMTIDDSPTARISNDFLDYQYSVLGILDYLNSPEVTEICINRPGELYLETINGWQRMEVPSLTFD
RARQFCTAVVNESNTGQRITDADPVVSLTFPTGQRAQFVIPPACDAGKVSITIRLPSKHTKTLEQYTSDG
FFDEVLEQAADVSEQDRELLELRRSKQYSEFFKKSVLYKKNVVVAGATGSGKTTFMKALVNHIPNEERLV
TIEDARELFISQPNSVHLLYSKGGQSASNVTAKSCMEACLRMKPDRIILAELRGDESFYFIRNCASGHPG
SITSCHAGSVEQTWDQLALMVKASNEGSGLEFEVIKRLLRMTIDIVVHIKAHAGRRFITGIDFDPARTLR
GG
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|21229478|ref|NC_003902.1|:c2948627-2947569 Xanthomonas campestris pv. campestris str. ATCC 33913 chromosome, complete genome
GTGAGCGCGACCACGGCCATGACGATCGACGATTCGCCGACAGCGCGGATCTCGAATGATTTCCTGGATT
ATCAGTACTCCGTACTGGGAATCCTGGATTATCTGAATTCTCCCGAAGTCACGGAAATTTGTATCAATCG
TCCTGGCGAGTTGTATTTGGAAACGATCAACGGCTGGCAGCGCATGGAGGTACCGTCGCTGACCTTTGAT
CGCGCCCGACAGTTCTGCACGGCAGTCGTCAACGAGAGCAATACTGGTCAGCGCATTACCGATGCCGATC
CGGTGGTCTCATTAACGTTTCCCACTGGCCAACGCGCACAGTTCGTAATTCCGCCCGCGTGCGATGCGGG
GAAGGTCTCGATCACGATTCGCTTGCCGTCCAAACATACCAAGACGCTCGAGCAGTACACCAGCGACGGG
TTCTTCGACGAGGTGCTTGAGCAAGCTGCGGATGTCAGCGAACAAGACCGCGAACTGCTTGAGTTGCGTC
GTAGCAAGCAGTACTCCGAATTCTTCAAGAAGTCGGTACTTTACAAGAAGAATGTAGTGGTGGCCGGTGC
GACTGGTAGTGGCAAGACTACTTTCATGAAGGCTCTTGTCAACCACATTCCGAACGAAGAACGCCTGGTT
ACCATCGAGGACGCCCGCGAGCTATTCATCAGCCAGCCGAATTCGGTGCATCTGTTGTACTCGAAAGGGG
GGCAGAGTGCGAGTAATGTGACCGCTAAGAGTTGCATGGAGGCCTGCCTGCGCATGAAGCCTGATCGGAT
CATCCTTGCTGAGTTGCGTGGTGACGAATCGTTCTATTTCATCCGCAATTGTGCATCCGGCCATCCTGGT
TCAATCACCAGCTGCCACGCAGGCAGCGTGGAACAGACCTGGGACCAGCTCGCGCTCATGGTGAAGGCCT
CCAATGAAGGTTCCGGGCTGGAGTTCGAGGTTATCAAGCGGCTGCTGCGCATGACCATCGATATCGTGGT
TCACATCAAGGCGCATGCTGGGCGCCGCTTTATTACTGGGATCGACTTCGATCCGGCAAGAACACTGCGT
GGCGGCTGA
 Primer design