SecReT4
Protein ID: 21231916
T4SS name [ID]VirB [389]
Gene symbolvirB8
Locus tagXCC2481
StrainXanthomonas campestris pv. campestris str. ATCC 33913
Repliconchromosome [GenBank: NC_003902] [Browse all T4SS(s) in this replicon]
Location [Strand]2950566..2951609 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ8P7X4
KEGG IDxcc:XCC2481
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.2e-56, Aligned region: 26..245
Protein Sequence: 347 a.a.     [Download]
>gi|21231916|ref|NP_637833.1| VirB8 protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
MTDLDMLRKKVSEKDGSAQVGAAVQKAVNYEVSIADLARRSERRAWLVATVSMLITVITAGGYYYMLPLK
EKVPYLVMADAYSGTSTIAKLEANYGGRTISTSEALARSNIARFILARESFDVSTIGDRDWNTVAAMAAT
NVLAEYRTLHAGNNPLRPFNTYGRSRAIRINILSITLVGGKGKAYTGATVRFQRNVYDKTSTVTTLLDNK
IATMGFAYQDNLQMSDSLRVENPLGFRVTDYRVDSDYSALPAAPASISTQAQAAPQASVYQQQMTPGMAE
QNVAGAAGQAGSPMQQVMPTGPGSAPMQQQQPGYPGQAQPQSASQPQAQPTIQPQGMPNNVNGASGR
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|21229478|ref|NC_003902.1|:c2951609-2950566 Xanthomonas campestris pv. campestris str. ATCC 33913 chromosome, complete genome
GTGACGGATCTAGACATGTTGCGTAAGAAGGTCAGTGAAAAGGATGGGTCCGCCCAGGTTGGCGCGGCCG
TCCAGAAGGCGGTCAATTACGAGGTGAGCATCGCTGATCTCGCGCGGCGCAGTGAAAGGCGCGCATGGTT
AGTTGCGACCGTTTCCATGTTAATCACCGTCATAACAGCTGGTGGTTACTACTACATGTTGCCGCTGAAA
GAGAAAGTGCCGTACCTTGTGATGGCTGATGCTTATTCTGGTACCAGTACTATCGCCAAGCTCGAAGCGA
ATTACGGCGGCCGCACCATCAGCACCAGTGAGGCATTGGCGCGCAGCAACATCGCGCGTTTCATCCTGGC
GCGTGAATCATTCGATGTGTCCACCATTGGTGATCGCGATTGGAACACCGTTGCAGCGATGGCAGCGACA
AATGTACTTGCCGAGTATCGCACGCTGCATGCCGGCAATAATCCACTGAGACCTTTCAATACATATGGAA
GGTCGCGCGCAATCCGGATCAATATTCTCAGTATCACCCTGGTTGGTGGCAAGGGTAAAGCATACACGGG
TGCGACCGTACGCTTTCAGCGCAATGTCTATGACAAGACATCTACTGTGACAACTTTGTTAGATAATAAA
ATTGCGACGATGGGGTTCGCCTACCAAGACAATCTGCAGATGAGCGATAGCCTTAGAGTGGAAAATCCTT
TAGGTTTCCGTGTGACTGATTATCGGGTCGATAGCGACTATTCGGCCTTGCCTGCAGCGCCGGCCTCAAT
CAGCACGCAGGCGCAGGCTGCACCACAGGCTTCCGTATATCAGCAGCAGATGACTCCAGGCATGGCTGAA
CAAAACGTAGCAGGCGCTGCGGGGCAGGCCGGCTCCCCCATGCAGCAGGTTATGCCTACGGGCCCAGGGA
GCGCGCCGATGCAACAGCAGCAGCCTGGATATCCTGGACAGGCGCAACCTCAGTCAGCCAGCCAACCTCA
AGCTCAGCCCACGATTCAACCTCAAGGGATGCCGAACAATGTCAATGGAGCAAGCGGTCGATGA
 Primer design