SecReT4
Protein ID: 21231918
T4SS name [ID]VirB [389]
Gene symbolvirD4
Locus tagXCC2483
StrainXanthomonas campestris pv. campestris str. ATCC 33913
Repliconchromosome [GenBank: NC_003902] [Browse all T4SS(s) in this replicon]
Location [Strand]2952459..2954132 [-]
ProductVirD4 protein
Component typeVirD4
UniProt IDQ8P7X2
KEGG IDxcc:XCC2483
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-110, Aligned region: 108..547
TraG-D_C [PF12696], Evalue: 1.2e-28, Aligned region: 398..511
TrwB_AAD_bind [PF10412], Evalue: 5.5e-24, Aligned region: 182..517
Protein Sequence: 557 a.a.     [Download]
>gi|21231918|ref|NP_637835.1| VirD4 protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
MSKLKIAAIATVVTMLIGYCLSGYLTLLLLRLDTKLYAWDTYYRYVSAMGLPEVAPYVTKIKLAGAFGFG
LPGIVWAIGMVLLVKPKQKALHGDARFAGAADLSKHGLFKPSPNGIVVGKFNGKLVRLSGQQFVILAAPT
RSGKGVGVVIPNLLEYQESVVVLDIKQENFDLTSGWRASQGHEVFLFNPFAEDRRTHRWNPLTYVSADPA
FRVSDLMSIAAMLYPDGSDDQKFWVSQARNAFMAFSLYLFENWDEELSLGFPGGAGAPTLGGIYRLSSGD
GTDLKKYLKSLSERRFLSSNAKSAFANMLSQADETFASIMGTLKEPLNAWINPVLDAATSADDFLLTDLR
KKKMTIYIGIQPNKLAESRLIINLLFSQIINLNTRELPKANPELKYQCLLLMDEFTSIGKVDIISTAVAY
MAGYNIRLLPIIQSMAQLDATYGKDLSRTIITNHALQILYAPREQQDANDYSEMLGYTTIKKKNVTRGRE
TTHSVSEERRALMLPQELKAMGNEKEVFLYEGIPHPVKCDKIRYYEDRYFTVRLLPKVGVATLTIKF
 
Nucleotide Sequence: 1674 bp     [Download]
>gi|21229478|ref|NC_003902.1|:c2954132-2952459 Xanthomonas campestris pv. campestris str. ATCC 33913 chromosome, complete genome
GTGTCCAAGCTCAAAATCGCCGCAATCGCCACCGTGGTGACGATGCTCATCGGGTATTGCCTGTCGGGCT
ACCTGACGTTGCTGCTATTGCGGCTGGATACCAAGCTGTACGCGTGGGACACCTACTATCGCTACGTCAG
CGCCATGGGTCTTCCGGAGGTTGCGCCGTACGTGACCAAGATCAAGTTGGCTGGGGCGTTCGGTTTCGGC
CTGCCGGGGATCGTCTGGGCAATCGGCATGGTGCTGCTGGTCAAGCCCAAGCAGAAGGCGCTGCATGGCG
ACGCGCGCTTTGCGGGCGCTGCCGACCTCTCCAAGCATGGGCTGTTCAAACCAAGCCCGAATGGCATCGT
AGTCGGCAAGTTCAATGGCAAGTTGGTCCGGCTCAGTGGCCAGCAGTTCGTCATCCTCGCCGCGCCGACG
CGCTCCGGTAAGGGCGTGGGCGTGGTCATTCCGAATCTGCTCGAGTACCAGGAATCGGTGGTGGTTCTGG
ACATCAAGCAGGAAAACTTCGATCTGACCAGCGGCTGGCGTGCCAGCCAGGGGCACGAGGTTTTTCTCTT
CAATCCGTTTGCGGAAGATCGCCGCACGCACCGCTGGAACCCGCTCACCTACGTGTCGGCCGATCCGGCC
TTCCGCGTCTCGGATCTGATGAGCATCGCCGCGATGCTGTACCCGGACGGTTCCGACGATCAGAAATTCT
GGGTCAGCCAGGCGCGCAACGCGTTCATGGCGTTCTCTCTTTATCTGTTCGAAAACTGGGACGAGGAGCT
GTCACTGGGCTTCCCGGGCGGGGCAGGGGCGCCTACGTTGGGCGGAATCTACCGTCTCTCGTCGGGTGAC
GGCACCGACCTCAAGAAATATCTGAAGTCGCTGTCCGAACGCAGGTTCCTCAGCAGCAACGCCAAGTCGG
CGTTTGCCAACATGCTGTCACAGGCGGATGAGACCTTCGCCTCCATCATGGGCACCCTGAAAGAGCCGCT
CAACGCCTGGATCAATCCCGTTCTGGACGCTGCTACCAGCGCCGACGATTTCCTGCTGACGGATCTGCGC
AAGAAGAAGATGACCATCTACATCGGCATCCAGCCCAACAAGCTGGCCGAGAGCCGCCTGATCATCAATC
TGCTTTTCAGCCAGATCATCAACCTCAACACCCGCGAACTACCCAAGGCCAACCCTGAGCTCAAATACCA
GTGCCTGTTGCTGATGGACGAGTTCACCTCGATCGGCAAGGTGGACATCATCTCCACTGCCGTGGCCTAC
ATGGCCGGCTACAACATCCGTCTGCTGCCCATCATCCAGAGCATGGCGCAGCTGGACGCCACCTACGGCA
AGGACCTCTCGCGCACCATCATCACCAACCACGCCCTGCAGATCCTCTACGCCCCGCGTGAGCAGCAGGA
CGCGAATGACTACTCCGAGATGCTGGGGTACACCACCATCAAGAAGAAGAACGTCACCAGAGGGCGTGAG
ACGACGCATAGCGTTTCCGAGGAGCGCCGGGCGCTGATGTTGCCGCAGGAGCTCAAGGCCATGGGCAACG
AGAAGGAAGTCTTCCTATACGAAGGAATCCCGCACCCGGTGAAGTGCGACAAGATCCGCTACTACGAAGA
CCGGTACTTCACTGTCCGGCTGTTGCCTAAGGTGGGCGTGGCGACCTTGACCATCAAATTTTGA
 Primer design