SecReT4
Protein ID: 21233858
T4SS name [ID]Tra_F [592]
Gene symbolorf196
Locus tagST585_p154
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]137437..137775 [-]
Productputative innermembrane protein
Component typeTraA_F
UniProt IDQ8L284
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-07, Aligned region: 2..94
Protein Sequence: 112 a.a.     [Download]
>gi|21233858|ref|NP_640156.1| putative innermembrane protein [Proteus vulgaris]
MKTLNRSNLKSVLAASAVIALGVTAAYANGTEQTGFSDVWKTITDYMQGSLGRVLVGLIVIVGVAAAVVR
QSLMVFAVAVGAAIGLYYSPDIIDGMMASTEGVTTVLPAAGI
 
Nucleotide Sequence: 339 bp     [Download]
>gi|21233663|ref|NC_003905.1|:c137775-137437 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAAAACTCTGAATCGTTCTAACTTAAAATCTGTTCTGGCCGCTTCTGCTGTTATTGCTCTGGGCGTAA
CTGCTGCATATGCAAACGGCACCGAACAAACTGGTTTCAGCGACGTGTGGAAAACCATCACTGACTACAT
GCAGGGTTCTCTGGGCCGCGTGTTGGTTGGCCTGATCGTTATCGTTGGTGTTGCGGCAGCGGTTGTTCGT
CAGTCACTGATGGTGTTCGCAGTGGCAGTTGGCGCAGCAATCGGTCTGTACTACTCTCCAGACATCATCG
ATGGCATGATGGCTTCTACCGAAGGCGTGACCACTGTACTGCCTGCGGCTGGTATCTAA
 Primer design