SecReT4
Protein ID: 21233863
T4SS name [ID]Tra_F [592]
Gene symbolorf201
Locus tagST585_p147
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]140885..143563 [+]
ProductDNA helicase
Component typeTraI_F
UniProt IDQ8L281
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 3e-119, Aligned region: 47..381
Protein Sequence: 892 a.a.     [Download]
>gi|21233863|ref|NP_640161.1| DNA helicase [Proteus vulgaris]
MFNRLKTLFSGKRTPKPTVNQIIMPAEVVEALTGSGDILRYPPAELGFPAQVPGFALLSLQEEIISKIKR
ELMIRDAEYDEYIQPMLTNFANFVHLLPASEFHHHRAQGGLLRHTLEVVLYSIKIAKSFEFDANESPVIK
SDRALAWRIAVVVGAVMHDIGKPISDVDVWDKSGEKHWMPAVHCLHEWAETEKIERYFIFWRSDRHERHH
NTSLTKMTDIVPKSLLAFLMQEGNDIYNELTEALAGSNSFRAVTSRNETGTVFKNKIHKIVAHADSRSVK
QDLQRYSGDAVRASQTGVPVIARIVDAMRLLIKKEEWKPNQAGSPLWVTTEGVFIVWGTAVTPIISIVKE
SGINVPHSADSLADIMLNYGLCVLNSNDSVYWRLAPHILNDKISRQNKEPKNALSCIKLVDPVVLFTDDV
MPNPTSCRIKLADGWKEFTGAGLTKQKSQPSRPYVGEKPPERVLNVDPDILKGGSLPPTDDLPPDGTVVK
RGTVIEQKNIVDHMLRMNLLSPENAAAIKSRNENEAKAKAESQDVEASPKPAETSVPAPAKGKAEAELSD
KKSRSQNKKSEKAASPVAEKAVPEQTEDQGELFGIDNRYNDYPHVDTDEENDTYDLMEQYNNQTQEEPPL
TLQERMARAAIQKQYEQDERNINQDGAPKESSWEKARAKIRQAQDITDGHAVTSDTYPHTESADVSAFID
DDHHFSAMFNDGPDEAKQILKRLVKERAGELFADNYHLFVHKQNEQDEHDYTVLVNAGWVWKPFLEPMDN
FQLYKSKPGFLLRRGLNEDIDYLSGGTYLKSIYPVDPNKSYCTDSALYRAIASYGLLKQTFDNKDVIAIS
GSAIRNMAKSLRIDTVTVRFLICYNFDSVSKRGSEHVLVDENIKPYMVDSHE
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|21233663|ref|NC_003905.1|:140885-143563 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGTTCAATAGATTAAAGACGTTGTTTTCAGGTAAGAGAACACCGAAACCAACTGTTAACCAGATTATCA
TGCCCGCAGAGGTGGTCGAAGCGCTTACCGGAAGTGGTGACATCCTTCGCTACCCACCAGCTGAATTGGG
TTTTCCGGCTCAAGTTCCGGGCTTTGCATTGCTGTCTTTGCAGGAAGAAATCATTTCCAAAATAAAACGT
GAATTGATGATCCGTGACGCAGAATATGATGAATACATTCAGCCGATGCTGACGAACTTCGCCAACTTTG
TTCACCTGTTACCTGCGTCTGAATTTCACCATCATCGTGCTCAAGGCGGGCTACTACGTCATACGCTTGA
GGTGGTGCTTTATTCAATAAAAATCGCGAAAAGCTTCGAGTTTGATGCAAACGAGTCACCTGTTATCAAA
TCTGACAGGGCTTTAGCATGGCGTATTGCTGTTGTCGTGGGCGCGGTCATGCACGACATCGGCAAACCTA
TCTCTGATGTCGATGTATGGGATAAATCCGGGGAAAAACACTGGATGCCTGCGGTTCATTGCCTCCATGA
ATGGGCCGAAACTGAAAAGATTGAGCGGTACTTTATTTTCTGGAGATCGGATAGGCATGAGCGTCATCAC
AATACCAGCCTAACCAAAATGACTGACATTGTACCTAAATCGCTTTTGGCGTTCTTAATGCAGGAAGGGA
ACGACATTTATAACGAGCTCACCGAAGCACTCGCAGGCAGTAACTCGTTTCGCGCCGTAACTTCTCGCAA
TGAAACTGGGACAGTCTTCAAAAATAAAATCCATAAAATTGTTGCTCACGCAGACAGCCGCTCGGTTAAG
CAAGACCTCCAGCGTTATTCCGGGGATGCCGTGCGTGCGTCTCAAACTGGTGTGCCGGTCATTGCCCGTA
TTGTCGATGCCATGCGTCTTCTGATCAAAAAGGAAGAGTGGAAACCCAATCAGGCAGGATCACCTCTCTG
GGTGACTACGGAAGGGGTATTTATCGTCTGGGGAACTGCTGTTACTCCTATCATCAGTATAGTGAAAGAG
TCTGGTATTAACGTACCACACTCAGCCGATAGCCTTGCCGATATCATGCTGAACTATGGCCTCTGCGTGC
TCAATTCCAATGACTCTGTTTACTGGCGTTTAGCGCCCCATATCCTTAACGATAAGATATCTCGCCAAAA
CAAAGAACCGAAAAACGCCCTCAGCTGCATAAAGCTGGTTGACCCGGTTGTACTCTTTACTGATGACGTT
ATGCCTAACCCGACATCCTGCCGGATAAAACTTGCGGATGGTTGGAAAGAATTTACCGGTGCGGGCTTAA
CCAAACAAAAGTCACAGCCAAGTCGCCCTTATGTTGGCGAAAAGCCTCCTGAGCGCGTGCTGAATGTTGA
CCCTGACATATTGAAGGGTGGTTCCCTGCCCCCTACTGATGACCTACCTCCTGATGGAACCGTTGTTAAA
CGCGGGACAGTGATTGAGCAAAAAAATATCGTCGATCATATGCTGCGTATGAACCTCCTTTCGCCAGAAA
ATGCAGCTGCAATCAAGTCCCGGAATGAAAACGAGGCAAAGGCTAAGGCCGAGTCTCAGGACGTTGAGGC
AAGCCCAAAACCAGCAGAAACATCGGTTCCGGCTCCAGCCAAAGGAAAAGCAGAAGCAGAACTTTCAGAT
AAAAAGTCTCGCTCTCAAAATAAAAAGTCTGAAAAAGCAGCCTCTCCCGTCGCTGAAAAAGCTGTTCCTG
AACAAACTGAGGATCAGGGTGAACTCTTCGGAATTGACAACAGATACAACGACTACCCTCACGTCGATAC
TGATGAAGAGAATGATACCTATGACCTTATGGAACAGTACAACAACCAGACTCAGGAAGAACCACCTCTG
ACCCTGCAAGAGAGAATGGCGCGTGCGGCCATCCAGAAACAATACGAGCAGGATGAAAGGAACATTAATC
AGGATGGTGCCCCAAAAGAAAGTAGCTGGGAAAAAGCACGCGCCAAAATCCGGCAAGCTCAGGACATTAC
AGACGGTCATGCAGTTACGTCAGACACGTATCCACATACAGAATCAGCCGATGTTTCAGCCTTTATTGAC
GATGACCATCACTTCTCTGCCATGTTTAACGATGGCCCAGATGAAGCAAAACAGATCCTCAAAAGGCTGG
TGAAAGAGCGAGCGGGTGAACTCTTTGCTGATAATTATCATTTATTTGTTCACAAACAAAATGAACAAGA
CGAGCACGATTATACCGTTTTGGTTAATGCTGGTTGGGTATGGAAACCGTTTCTTGAGCCAATGGATAAT
TTCCAACTCTATAAATCAAAGCCGGGGTTTCTACTGAGACGCGGACTAAATGAGGACATTGATTATTTAT
CAGGCGGTACATACCTGAAAAGTATCTACCCTGTAGATCCAAATAAAAGTTATTGCACTGATAGCGCCTT
ATATCGCGCCATCGCTTCCTACGGTCTGCTTAAACAAACCTTTGATAATAAAGATGTGATTGCAATTAGC
GGTTCAGCTATCAGAAACATGGCAAAGTCCCTGCGGATAGACACAGTAACTGTTCGCTTCCTGATTTGTT
ACAACTTTGATTCAGTGAGCAAGCGTGGATCAGAGCATGTATTAGTGGATGAAAATATTAAACCTTACAT
GGTGGATTCTCATGAGTGA
 Primer design