SecReT4
Protein ID: 21233864
T4SS name [ID]Tra_F [592]
Gene symbolorf202
Locus tagST585_p146
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]143556..145523 [+]
ProductDNA transfer
Component typeTraD_F
UniProt IDQ8L280
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.6e-16, Aligned region: 157..550
TrwB_AAD_bind [PF10412], Evalue: 3.4e-08, Aligned region: 155..193
FtsK_SpoIIIE [PF01580], Evalue: 4e-08, Aligned region: 142..198
TraG-D_C [PF12696], Evalue: 4.4e-08, Aligned region: 470..562
DUF87 [PF01935], Evalue: 1.1e-06, Aligned region: 150..194
Protein Sequence: 655 a.a.     [Download]
>gi|21233864|ref|NP_640162.1| DNA transfer [Proteus vulgaris]
MSEWKYNMPWRPNYEAFEVAGWSAGIASSLAVNAFFDMPSLPCYMAVAVQAAYGIRALPDAYYVYKHKRR
LAKKPDVLIMRIEQIIDAMIKYPDCYIFGKGFQWGQNEGQSAFELLKRDIKKLTAKTDDDFMGLGWIHQV
GSDNDYVRTVENLLSLHTLITGTTGSGKTTYYKLIILQAALKRQPLVMVDPKNDEALAQWMEMCLSFVNR
AEKLNYFSLAHPEKSVRISPITNFTRSGEVANRIISVIQRGDSTSDPFISFATMSLTSILEMMKMCEIKP
TLKSLKTQLGSNITALAELVTQAITKVGREVLPHGMFDSVLAGKKSRMSGKVVDSVSIAKLCAEIYMDDI
RHNKAFPDIEAGIDTLSHNREHFQKMILNVMPILSQLTTGFMGDLLSPDTFDPDQMEDDRPIANVREIIS
TNGMLYLGLDALSDGDTAAAVGSIFLSDITSVASEIYNFMQPRGEDIANVIILIDEAAEVINDQVIKMLN
KSRGAGFCMFIASQGTSDFEARLGSEAKMEQIIVNTNHFTALRTPAPKAQKAIMERVPLTKFKYIMRGHG
SSSGTDPEQITGSIGERLMEEESEMFPAPLLGWLPNLEFFALNQAKVIIKGKVPILTKPKDENEIKRIKA
KAAKFQAVYEKKVRGEKVRSKLANA
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|21233663|ref|NC_003905.1|:143556-145523 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAGTGAGTGGAAATACAACATGCCTTGGCGTCCTAACTACGAGGCATTTGAAGTCGCCGGTTGGTCTG
CTGGTATAGCAAGTTCCTTGGCGGTAAATGCCTTTTTTGATATGCCATCTCTCCCCTGCTATATGGCCGT
TGCAGTCCAAGCCGCTTATGGTATTCGTGCTTTGCCGGATGCCTATTACGTGTATAAGCACAAACGTCGC
TTAGCGAAGAAGCCAGATGTATTAATCATGAGAATTGAGCAAATCATTGATGCAATGATTAAGTATCCAG
ATTGCTATATTTTCGGTAAGGGTTTTCAGTGGGGGCAGAATGAAGGGCAATCTGCATTTGAACTATTAAA
GCGTGATATCAAGAAACTGACAGCCAAGACCGATGATGACTTTATGGGCCTGGGCTGGATTCATCAAGTC
GGCTCTGACAATGATTATGTCCGTACCGTTGAAAACTTATTATCACTGCACACACTGATAACCGGAACAA
CGGGTTCAGGTAAAACAACGTATTATAAACTCATCATTCTCCAAGCTGCATTGAAGAGACAGCCACTCGT
TATGGTTGACCCAAAAAATGATGAAGCCTTAGCTCAATGGATGGAAATGTGTTTGTCGTTCGTTAACCGT
GCGGAAAAGCTAAACTATTTTTCACTGGCCCATCCTGAGAAATCAGTGCGCATCTCACCTATCACCAACT
TCACTCGATCCGGCGAGGTCGCGAACCGTATCATCTCCGTTATTCAACGCGGTGACTCGACCAGTGACCC
ATTTATTTCATTCGCCACCATGTCTTTAACCAGCATTCTCGAAATGATGAAGATGTGCGAAATCAAGCCA
ACGCTAAAAAGCCTCAAAACACAATTAGGCTCAAACATTACGGCGCTGGCGGAGCTCGTTACTCAGGCCA
TCACAAAGGTAGGCCGCGAAGTTCTTCCTCATGGCATGTTTGATAGCGTGCTGGCCGGAAAGAAAAGCCG
TATGAGCGGGAAGGTTGTTGACTCCGTTTCTATTGCAAAACTGTGTGCTGAAATCTACATGGATGATATC
CGGCACAACAAAGCGTTCCCGGACATTGAAGCGGGTATTGATACCCTGAGTCATAACCGCGAACACTTCC
AGAAGATGATCCTGAACGTCATGCCCATCCTGTCCCAGTTAACAACTGGTTTTATGGGCGATTTACTGTC
TCCTGATACCTTCGACCCTGATCAGATGGAAGATGACCGACCTATCGCCAATGTGCGCGAAATTATCAGC
ACCAACGGCATGTTATATCTTGGCCTTGACGCCCTTTCTGACGGTGACACTGCTGCGGCGGTGGGCTCAA
TTTTCCTGTCAGATATCACCAGCGTGGCATCCGAAATATATAACTTTATGCAGCCACGAGGCGAAGATAT
TGCTAACGTCATCATCCTGATCGATGAGGCCGCTGAGGTCATTAATGATCAGGTCATCAAGATGCTGAAC
AAATCGCGTGGCGCTGGGTTCTGTATGTTCATCGCTTCACAGGGTACGTCTGACTTTGAGGCCCGTTTAG
GCTCTGAGGCAAAGATGGAACAAATCATCGTCAATACCAACCACTTTACTGCATTGCGAACTCCAGCCCC
CAAAGCACAAAAGGCAATCATGGAGCGCGTCCCACTGACTAAATTCAAATACATCATGCGCGGCCACGGC
TCTAGTTCAGGTACTGACCCTGAGCAAATCACGGGCAGTATCGGTGAGCGCCTGATGGAAGAAGAAAGCG
AAATGTTCCCCGCCCCGCTTTTAGGATGGCTTCCAAACCTCGAGTTTTTCGCTCTCAATCAGGCGAAAGT
GATTATTAAGGGAAAAGTACCGATTTTAACCAAGCCAAAAGATGAGAACGAAATAAAAAGAATAAAGGCT
AAAGCAGCGAAATTTCAGGCTGTTTACGAGAAAAAAGTCCGTGGCGAAAAAGTTCGCTCAAAATTAGCAA
ACGCGTAA
 Primer design