SecReT4
Protein ID: 21233869
T4SS name [ID]Tra_F [592]
Gene symbolorf207
Locus tagST585_p141
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]147871..148155 [+]
Productpilus biogenesis protein
Component typeTraL_F
UniProt IDQ8L279
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.6e-27, Aligned region: 4..93
Protein Sequence: 94 a.a.     [Download]
>gi|21233869|ref|NP_640167.1| pilus biogenesis protein [Proteus vulgaris]
MEPIKISHSVDDPQKIFFWTIDEALPFFFFLMLGIFTGRILTFVIIGIVITRYYGSFLQRASENYFLHLC
YWNLGVSFGKSTIVPNSFEREFVV
 
Nucleotide Sequence: 285 bp     [Download]
>gi|21233663|ref|NC_003905.1|:147871-148155 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGGAACCAATCAAGATTTCACATTCTGTAGATGACCCTCAGAAGATATTTTTCTGGACTATCGACGAAG
CTTTGCCTTTCTTCTTTTTCCTGATGCTTGGGATCTTCACTGGCCGAATCCTGACGTTCGTCATTATCGG
CATTGTGATTACCCGGTACTACGGTAGTTTTTTGCAGCGTGCATCTGAAAATTACTTTTTACACCTGTGC
TACTGGAACCTCGGCGTTTCTTTCGGAAAAAGCACGATTGTACCTAACTCTTTTGAACGGGAATTTGTTG
TATGA
 Primer design