SecReT4
Protein ID: 21233870
T4SS name [ID]Tra_F [592]
Gene symbolorf208
Locus tagST585_p140
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]148152..148769 [+]
Productpilus biogenesis protein
Component typeTraE_F
UniProt IDQ8L278
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-13, Aligned region: 12..145
Protein Sequence: 205 a.a.     [Download]
>gi|21233870|ref|NP_640168.1| pilus biogenesis protein [Proteus vulgaris]
MKTQAFKKGLLQMTAEISTLKWVVLGLLGVVVILSATLMSRSQVVTIVPPNLTQTAWLDEHAASAPYMSA
WAVYVAQSLGNANPSSVNMVKESIGPFLDAKIYNEMMKRIDDQIDQIKRDRISLYFTPNRVITDPAAPGT
FFVEGNQGLEGITGQPVVKLMTFQINVDIKGYRPVITYVNIKQGKAVLPSEAAKRGGKGNTSGEK
 
Nucleotide Sequence: 618 bp     [Download]
>gi|21233663|ref|NC_003905.1|:148152-148769 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAAAACACAGGCATTTAAAAAAGGTCTTCTACAGATGACCGCTGAGATTTCGACCCTGAAATGGGTCG
TGTTAGGCTTATTGGGTGTGGTGGTAATTCTTTCGGCAACGCTTATGTCCCGTTCTCAGGTCGTCACTAT
CGTACCTCCGAACCTGACACAAACTGCGTGGCTGGATGAACATGCTGCTTCCGCGCCGTATATGAGCGCG
TGGGCGGTTTATGTTGCTCAGTCTCTAGGTAATGCAAACCCTTCATCGGTCAACATGGTGAAAGAGTCTA
TTGGGCCGTTCCTTGATGCGAAGATTTACAACGAAATGATGAAGCGTATTGATGACCAGATTGATCAGAT
TAAACGCGACCGTATCAGTCTGTATTTTACGCCTAATCGTGTCATCACCGACCCTGCCGCTCCCGGAACC
TTTTTTGTGGAAGGTAATCAGGGACTGGAAGGTATTACAGGTCAGCCCGTAGTTAAGCTAATGACTTTTC
AGATTAATGTGGATATTAAGGGGTATCGTCCGGTCATCACTTACGTGAACATCAAGCAAGGAAAGGCTGT
TTTGCCTTCCGAAGCGGCGAAACGCGGTGGTAAAGGCAATACCTCGGGGGAAAAATAA
 Primer design