SecReT4
Protein ID: 21233871
T4SS name [ID]Tra_F [592]
Gene symbolorf209
Locus tagST585_p139
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]148769..149935 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ8KJZ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.5e-24, Aligned region: 133..366
Protein Sequence: 388 a.a.     [Download]
>gi|21233871|ref|NP_640169.1| hypothetical protein [Proteus vulgaris]
MKLPVKSSLAMIVSLVIAGSAIAEDLNGFGLPFADNSVGEQQSGSEKTTLSIDEGIVLGNAQPSNKPVVV
PAGKPVVSNANTNAGRGNHTATAGASRNSNRRDNPAVDGVNIQAVQNKIVEPIKLTDDVIPSRQDIIVEP
GVNTLIPISMGQINRIVTPFERPTIQRLQLDDVKVNVEGNAVYVYTPNSRPVALYISEKGDESVSISVSL
VPQRIAPVQATLMLSRKLNNAAVAGGGVSPIMYGGSEAKAKKWEQKDSYVETVRNILRTVALGDIPPGYA
LGNLTSSVSIPNCNFNTGTVQDYIRYNFNGGQYINGSQFSVIVGIAQNTGPTTVTVDESLCTHPQMAARA
LWSRNTLAPGQKTEAYFVLRNGQQQVRVDDGARPKLAE
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|21233663|ref|NC_003905.1|:148769-149935 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAAATTACCAGTTAAGTCATCACTGGCTATGATCGTGTCTTTGGTCATTGCAGGCTCAGCCATAGCCG
AAGATTTAAACGGTTTTGGCTTGCCTTTTGCTGATAATTCTGTGGGGGAACAGCAAAGTGGTTCTGAGAA
AACAACGCTCTCCATTGATGAGGGCATTGTTTTAGGTAACGCTCAACCAAGCAATAAGCCGGTTGTTGTG
CCTGCCGGTAAACCTGTTGTTAGCAACGCTAATACCAATGCTGGCCGTGGCAATCATACTGCTACGGCTG
GCGCGTCTCGTAACTCTAATCGCAGAGACAATCCGGCTGTTGATGGGGTTAATATTCAGGCTGTTCAAAA
CAAAATTGTTGAACCTATCAAACTCACCGATGATGTTATCCCGTCGCGTCAGGACATCATTGTAGAGCCG
GGAGTGAATACGTTAATCCCTATCTCAATGGGTCAAATTAACCGTATCGTTACTCCGTTTGAGCGCCCTA
CCATCCAGCGGTTGCAGCTCGATGATGTGAAGGTCAATGTCGAAGGCAACGCGGTTTATGTTTATACGCC
AAACTCTCGTCCAGTCGCGCTGTACATCAGTGAGAAAGGCGATGAAAGCGTGTCTATCTCTGTCTCTCTT
GTGCCTCAGCGTATCGCCCCGGTGCAAGCCACGCTGATGCTCTCTCGCAAATTAAACAATGCGGCTGTAG
CTGGTGGCGGAGTGTCACCCATAATGTATGGCGGAAGCGAAGCGAAAGCTAAAAAATGGGAACAGAAGGA
TAGCTATGTAGAGACGGTCAGAAACATTCTCCGTACCGTGGCGTTAGGTGACATCCCCCCCGGTTATGCA
CTGGGGAATCTCACCTCTTCCGTAAGTATCCCTAACTGTAATTTCAATACCGGCACTGTGCAGGACTACA
TCCGCTACAACTTTAACGGCGGGCAGTACATTAATGGCAGTCAGTTCAGTGTCATTGTTGGTATTGCACA
AAACACGGGCCCAACGACTGTTACCGTTGATGAATCACTCTGTACTCACCCACAAATGGCCGCTCGTGCA
TTGTGGAGCCGTAATACGCTTGCTCCGGGTCAAAAGACAGAAGCCTATTTTGTCCTGCGAAATGGTCAAC
AACAAGTACGTGTTGATGACGGTGCTCGTCCTAAGTTAGCGGAGTGA
 Primer design