SecReT4
Protein ID: 21233872
T4SS name [ID]Tra_F [592]
Gene symbolorf210
Locus tagST585_p137
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]149932..151290 [+]
Productpilus biogenesis protein
Component typeTraB_F
UniProt IDQ8L277
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.8e-45, Aligned region: 233..440
Protein Sequence: 452 a.a.     [Download]
>gi|21233872|ref|NP_640170.1| pilus biogenesis protein [Proteus vulgaris]
MIFMEKLKDLWANLDAKKKRYALWAGLAIVIIPLLLVIMPENSSPRSKATKEKVIQNVLTDSDTTGVSQN
AIAARLRSLDETIKSTKTAVDTLNKTLDPDALNKRLTNIENVQKNEAAARQTLNNRIDTLIKNPPASSTG
GALNPKNVFAAPQDGQSGEAAENQPQNARATASGTLQSVYENDIAPDPSDFDHSADASKSKNEAPASVPN
IVTVQQDIKEEHDSDEDTGPETYLPATSIISGVFISGMDAPTAQNARNDPYPALIRIKKDAILPNRFRVD
IRECGMLAAGFGDLSSERAYFRSEVITCIREDGAVFEASIDAYAVGEDGKAGVRGRLVTKQGQYLAKALT
AGFLQAASQLFSVQSIPTINVNRDGNSRGGSPYEQVMSSQAMQGAAISGVGGALNRLADFYMKMATDLFP
VIEIDPARSVDFVVQKGVSLKFNKVTSVGGNK
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|21233663|ref|NC_003905.1|:149932-151290 Proteus vulgaris plasmid Rts1 DNA, complete sequence
GTGATATTCATGGAAAAATTAAAAGATCTTTGGGCTAATCTCGACGCTAAAAAGAAACGCTATGCGCTTT
GGGCTGGACTTGCAATCGTAATTATCCCGCTTCTACTTGTCATCATGCCTGAGAACAGCTCACCTCGTTC
CAAGGCAACAAAGGAAAAGGTTATTCAGAACGTTTTGACTGACTCTGATACTACAGGGGTTAGCCAGAAC
GCAATTGCGGCACGACTTCGCTCTCTTGATGAGACAATTAAGAGCACAAAGACAGCCGTCGATACGCTGA
ATAAAACGCTTGATCCCGACGCACTGAACAAGCGCCTTACCAATATTGAGAACGTACAAAAAAATGAGGC
AGCGGCAAGACAAACCCTCAATAATCGCATTGATACGCTGATTAAGAACCCGCCTGCCAGTTCGACTGGT
GGCGCACTTAATCCAAAAAATGTTTTTGCTGCACCTCAAGATGGGCAATCAGGCGAAGCAGCTGAAAATC
AACCTCAGAATGCAAGGGCTACAGCAAGCGGAACACTGCAAAGTGTTTATGAAAACGATATTGCGCCTGA
TCCGTCTGATTTTGACCATTCAGCTGATGCGTCTAAATCCAAGAATGAAGCTCCTGCGTCTGTGCCGAAC
ATTGTCACCGTTCAGCAAGACATCAAAGAAGAGCATGATTCAGATGAAGATACTGGCCCTGAAACCTATC
TCCCTGCCACCAGCATAATCTCTGGTGTATTTATCTCGGGGATGGACGCACCAACAGCTCAGAATGCACG
TAATGACCCGTACCCTGCCCTGATCCGTATTAAGAAAGATGCCATCCTGCCAAACCGTTTCCGTGTGGAT
ATCAGAGAGTGCGGGATGCTGGCAGCAGGTTTTGGTGATCTGTCCTCTGAACGAGCTTACTTCCGCTCAG
AAGTCATTACTTGTATCCGTGAAGACGGTGCCGTATTTGAGGCGTCTATTGATGCTTACGCAGTCGGAGA
AGATGGTAAAGCTGGTGTACGTGGTCGTCTGGTGACGAAACAAGGCCAGTATTTAGCAAAAGCTTTAACA
GCAGGATTCCTGCAAGCCGCCTCTCAGTTGTTTAGCGTGCAGTCTATACCAACGATTAACGTGAACCGTG
ACGGTAATTCGAGAGGTGGTAGTCCTTATGAGCAAGTAATGAGCAGTCAAGCCATGCAGGGTGCAGCCAT
TTCCGGCGTAGGTGGTGCGCTGAATCGTTTAGCAGATTTTTATATGAAAATGGCTACCGATCTGTTCCCT
GTTATTGAAATCGACCCGGCCCGTAGCGTGGATTTTGTTGTGCAAAAAGGCGTGTCGTTGAAGTTTAATA
AAGTTACAAGTGTTGGGGGTAATAAATGA
 Primer design