SecReT4
Protein ID: 21233873
T4SS name [ID]Tra_F [592]
Gene symbolorf211
Locus tagST585_p136
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]151287..151877 [+]
Productpilus biogenesis protein
Component typeTraV_F
UniProt IDQ8L276
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.1e-22, Aligned region: 29..146
Protein Sequence: 196 a.a.     [Download]
>gi|21233873|ref|NP_640171.1| pilus biogenesis protein [Proteus vulgaris]
MSTKRIMLALLGVASAVALTGCSSLVGGESEYGCKGMPDAVTCMSMGEVYELTDGSNYKERVSEVSQQQL
SGKQVNVKQVTAGGNGAGPSVSAGAAYVPVPVPVSNPQPIRTPSQVMRVLVDSYESADGDLNVPGYVYTE
IEPRRWEIGASRGSTVQPVIRPMQVPVSAEPLPETGKGNSNANASRTQSTNKRTMM
 
Nucleotide Sequence: 591 bp     [Download]
>gi|21233663|ref|NC_003905.1|:151287-151877 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAGCACTAAACGTATCATGTTAGCGCTACTGGGTGTCGCAAGTGCGGTGGCCCTTACGGGGTGTTCTT
CGCTGGTGGGCGGGGAATCTGAATATGGCTGTAAAGGTATGCCTGACGCTGTGACTTGTATGAGTATGGG
CGAAGTCTACGAACTAACTGATGGCAGTAATTATAAAGAGCGTGTCAGTGAAGTTTCTCAGCAACAGCTG
TCCGGGAAACAAGTAAACGTAAAGCAAGTAACTGCCGGTGGTAATGGTGCAGGCCCATCGGTAAGTGCTG
GTGCGGCGTATGTGCCTGTTCCTGTTCCAGTGTCAAACCCACAACCTATTCGTACACCTTCACAAGTCAT
GCGTGTTTTGGTTGACTCGTATGAATCAGCTGATGGTGACTTAAATGTACCGGGCTATGTCTATACTGAA
ATTGAACCTCGCCGCTGGGAAATTGGTGCAAGTCGAGGATCTACTGTACAACCTGTAATCAGGCCAATGC
AGGTTCCGGTTAGCGCCGAGCCTCTTCCTGAGACTGGAAAAGGCAATTCAAATGCGAATGCGTCTCGTAC
TCAAAGCACAAACAAACGCACTATGATGTAA
 Primer design