SecReT4
Protein ID: 21233875
T4SS name [ID]Tra_F [592]
Gene symbolorf213
Locus tagST585_p134
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]152959..155445 [+]
Productpilus biogenesis protein
Component typeTraC_F
UniProt IDQ8L274
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.3e-52, Aligned region: 456..751
TraC_F_IV [PF11130], Evalue: 8.2e-49, Aligned region: 14..261
Protein Sequence: 828 a.a.     [Download]
>gi|21233875|ref|NP_640173.1| pilus biogenesis protein [Proteus vulgaris]
MSESLIVRKLKGIKRFSDVCPVNAYDEKNRLFTLENKYIAFGFVCRPLAGSTGKETDQLKTLLSSNFPPK
TIVQWDLIASPNIVKKINQMDFLRINCEDPILKNAIYNRSKFLLHSTDYPMKGVGTRVRDCLLVCTVKIP
IKANYEPKDEEMNLFNEFRTSFDTSLGILGLAPSPLTRESYIDILASVLNQGENASWRDRSPVQVQDDLL
VSEQLVDPDRSFFIRSKYVAFGNPEDEKQRGERQTETTFIRTLSAKKLPTRFWPGQAQYYLGDLMSGATG
IKSSCIISMSLIFNDQQSAKSTFTRKRAWVVQQSDGPMAKLIPSYKTSREGFDILADKLDNGEPVCRAKF
TVSIFSNSKDGVFRASQEAASYLNTYQFKMVPDTNFVAPIFLSALPMFNEASAEKVIGRYRTLALSEALV
LTPLYADWQGTKNPALMLTSRSGQIQMIDLFDSDTNYNACIAAESGSGKSFLTNYIITAYRSLGAKVWCI
DVGDSYKNICETYGGDYLDFHPDKKPCLNFFELIEDYFGEDPTNTDGNGEEDLIIGLLTVMAAPQKGLDD
FQTARLKEHVALLIREHGKQTTVDMVAESCLKDADRRVSDIGSQLYPFTSRGQYGRYFVGKNNIDFRNPF
TVLELSRLESSEHLKQVVLLQLIYQIQQDMFLGDRSQMKIVVIDEAWALLKGNIGDFIEKGYRRFRKYKG
AAITITQSINDIYKDSVGKAIADNSAFMLLLGQGESAINEAQASKRLALDDAGYRFLKTVRSSSGVYSEV
FVISKAGQGISRLIVDPFSLLLYSTHPDDVSEIRRKKDGGLTTEQAIYEILRDRGVAA
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|21233663|ref|NC_003905.1|:152959-155445 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAGTGAATCATTAATTGTTCGTAAATTAAAAGGGATTAAACGTTTTTCCGATGTGTGTCCGGTGAACG
CATATGATGAGAAAAATCGTCTCTTTACGCTGGAAAACAAATACATCGCATTCGGCTTCGTCTGTCGCCC
TTTGGCCGGGAGTACCGGAAAGGAAACTGATCAGCTGAAAACGTTGCTGTCATCAAATTTTCCGCCAAAA
ACTATCGTGCAATGGGATCTCATTGCCAGCCCAAATATCGTGAAGAAAATAAATCAGATGGATTTCCTTC
GTATCAATTGCGAAGACCCCATTCTGAAAAATGCAATTTATAACCGTTCTAAATTTCTTTTACATAGTAC
CGATTACCCTATGAAGGGGGTTGGTACTCGCGTGCGTGACTGCCTGCTTGTCTGCACCGTAAAAATTCCT
ATAAAAGCCAATTACGAACCCAAAGATGAGGAAATGAACTTATTTAATGAGTTCAGAACTAGCTTTGATA
CATCGCTCGGCATACTTGGCCTTGCTCCTTCTCCGTTGACTCGTGAATCCTATATTGACATCCTTGCCTC
TGTACTTAATCAGGGCGAAAACGCCAGCTGGCGTGACCGCTCTCCTGTTCAGGTTCAGGATGACTTGCTG
GTTTCAGAGCAATTGGTTGACCCTGATCGCTCTTTCTTCATCCGCTCAAAATATGTCGCCTTTGGTAATC
CCGAAGATGAAAAGCAGCGCGGGGAACGGCAGACAGAAACCACATTTATCAGGACACTGAGCGCAAAAAA
ACTCCCTACCCGCTTTTGGCCCGGACAGGCACAATATTATCTTGGCGACTTAATGAGTGGCGCTACTGGT
ATTAAAAGCTCCTGTATCATTTCCATGAGCCTCATTTTTAATGACCAGCAAAGTGCCAAATCAACATTTA
CACGAAAAAGGGCATGGGTTGTTCAGCAAAGTGATGGCCCTATGGCGAAATTGATCCCGTCTTACAAAAC
TTCCCGCGAAGGCTTTGATATCTTGGCTGACAAACTCGATAACGGTGAACCAGTCTGTCGCGCAAAGTTT
ACTGTGAGCATTTTCTCTAACTCAAAAGATGGCGTATTCCGGGCATCTCAGGAAGCTGCAAGCTATCTCA
ACACGTATCAGTTTAAAATGGTTCCTGATACAAACTTTGTTGCCCCGATTTTCCTTTCTGCCCTCCCGAT
GTTTAATGAGGCAAGTGCAGAAAAAGTCATTGGCCGTTATCGCACCCTTGCCCTGAGTGAAGCCCTTGTT
CTCACACCTCTATATGCTGACTGGCAGGGTACAAAAAACCCGGCGTTAATGTTGACATCGCGCTCTGGTC
AGATACAGATGATTGACTTGTTCGACTCAGACACCAACTACAACGCCTGTATTGCTGCGGAATCCGGTTC
TGGTAAATCCTTCCTGACGAACTACATCATTACCGCTTACAGAAGCCTTGGTGCAAAAGTTTGGTGTATC
GATGTCGGTGATTCGTACAAAAATATCTGCGAGACATATGGGGGGGATTACCTCGATTTCCACCCGGATA
AAAAGCCATGTCTTAACTTCTTTGAACTGATTGAAGACTACTTTGGTGAAGATCCAACAAACACAGATGG
TAACGGTGAAGAAGACCTGATTATCGGCCTTCTGACGGTTATGGCCGCACCACAAAAAGGGCTGGATGAT
TTCCAGACTGCACGCCTTAAAGAACATGTTGCGCTACTTATCCGTGAACACGGGAAACAAACAACAGTCG
ATATGGTGGCGGAATCCTGTTTAAAAGATGCTGATCGGCGTGTAAGCGACATTGGCTCTCAGCTTTATCC
TTTCACAAGCAGGGGCCAGTACGGCAGATACTTTGTTGGTAAAAATAATATCGACTTTAGAAATCCGTTT
ACCGTCCTTGAACTTTCACGTCTTGAAAGCTCTGAGCACTTGAAACAAGTCGTTCTCTTGCAGCTGATTT
ACCAGATTCAGCAAGACATGTTCTTGGGTGATCGTTCACAAATGAAAATCGTTGTTATCGATGAAGCGTG
GGCGCTTCTCAAAGGCAATATTGGTGACTTCATTGAGAAAGGCTATCGTCGCTTCCGTAAGTACAAAGGT
GCGGCCATTACCATTACCCAGTCTATCAACGACATCTACAAGGACAGTGTGGGTAAAGCCATTGCTGATA
ACTCCGCGTTTATGCTTCTGCTCGGACAGGGTGAGTCTGCAATTAACGAGGCTCAGGCCAGTAAGCGCCT
TGCTCTTGATGATGCCGGTTATCGCTTCCTCAAAACAGTCAGATCAAGTAGCGGCGTTTACTCTGAGGTA
TTCGTTATCTCTAAAGCCGGGCAAGGTATTAGTCGTCTGATTGTCGATCCATTCTCCCTACTGCTCTACT
CCACACATCCTGATGACGTATCCGAAATCAGGCGTAAGAAGGATGGCGGGTTAACGACAGAGCAAGCTAT
CTATGAAATTCTTAGGGATAGAGGAGTTGCCGCATGA
 Primer design