SecReT4
Protein ID: 21233878
T4SS name [ID]Tra_F [592]
Gene symbolorf216
Locus tagST585_p131
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]156253..157503 [+]
Productpilus biogenesis protein
Component typeTraW_F
UniProt IDQ8L272
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 8e-27, Aligned region: 124..237
TrbC_Ftype [PF09673], Evalue: 8e-27, Aligned region: 362..406
Protein Sequence: 416 a.a.     [Download]
>gi|21233878|ref|NP_640176.1| pilus biogenesis protein [Proteus vulgaris]
MVTKQFFKVSVIAAVVLSSATAFSTETTLPSRPDIPATAVPERPVSLSEKDQSDLNELLKIAKQKQAEYE
KLSRDTVASSHKRLGEMPVPKTEHDIITDAVTGAIADSDMADGKQNKVTGDFYYVLLSSSLSDDEIRNIF
SQYKDRTDVAFVIRGVNDKDKILQELTHWQQLVLDAGGGATVNLDPTIFKSYNVTSIPTIIHEKDGELVA
RVSGISNTGYLKDKKGDLGVAGPTKDISEISLLDIIEQKIKTLDFDKMKTDALDNYWKKQEFTDFPPALK
HNQKFINPSVVIPQDILAPDGQVVAKQGRINPLDVIPFRLKLIFFDARIDWQRKIARREYQNAEPGIEPI
LITTNVYGDGWKTFQDAHEMYGEKSRLYMIQPGMADRFGITSVPSIVTATDKQYVINEYPEDEANK
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|21233663|ref|NC_003905.1|:156253-157503 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGGTGACAAAACAGTTTTTCAAAGTAAGTGTTATTGCTGCCGTGGTGCTATCAAGCGCCACGGCTTTTT
CAACTGAAACCACATTGCCATCCCGGCCAGATATTCCAGCTACAGCCGTTCCTGAGCGTCCTGTCTCGCT
GTCTGAGAAAGACCAGTCAGACCTCAATGAACTGCTAAAAATAGCCAAACAGAAGCAGGCAGAGTACGAA
AAGCTATCCCGTGATACCGTAGCCTCCAGTCACAAAAGACTCGGAGAAATGCCGGTGCCTAAAACTGAAC
ATGACATCATTACTGATGCAGTAACAGGCGCTATTGCTGATTCTGATATGGCCGATGGAAAACAGAATAA
AGTAACTGGTGATTTCTATTATGTCCTCCTGTCATCTTCACTTTCCGATGATGAGATACGTAACATCTTT
TCGCAGTACAAGGACAGAACGGACGTTGCTTTTGTTATTCGTGGCGTTAACGATAAAGACAAAATCCTGC
AAGAACTCACGCACTGGCAGCAGTTGGTGCTCGATGCTGGTGGTGGTGCTACCGTAAACCTCGATCCAAC
CATATTTAAAAGTTACAACGTCACGTCTATTCCAACCATTATCCATGAAAAAGACGGTGAGCTGGTGGCC
CGTGTCTCAGGCATTTCAAATACCGGATACCTGAAAGATAAAAAAGGTGATTTGGGTGTGGCTGGCCCGA
CAAAAGATATCAGCGAAATTAGTCTGTTAGATATCATTGAGCAGAAAATTAAAACGCTCGACTTTGATAA
AATGAAAACCGATGCTCTGGATAACTACTGGAAGAAACAGGAATTTACTGACTTCCCTCCTGCATTGAAG
CACAACCAGAAGTTTATCAATCCTTCCGTGGTCATCCCGCAAGACATCCTAGCACCAGATGGGCAAGTGG
TGGCGAAGCAAGGCCGGATCAATCCGCTCGATGTCATCCCTTTCCGGCTAAAACTCATTTTCTTTGATGC
GCGTATTGACTGGCAGAGAAAAATCGCCCGCCGTGAATACCAGAACGCCGAGCCCGGCATTGAACCAATC
CTGATAACAACTAACGTTTACGGGGATGGCTGGAAAACGTTTCAGGACGCGCACGAAATGTATGGCGAGA
AAAGCCGCCTCTACATGATTCAACCCGGCATGGCTGACCGCTTCGGTATCACCTCAGTGCCCAGCATTGT
GACGGCTACCGATAAGCAATATGTGATCAATGAATACCCCGAAGATGAGGCTAATAAATAA
 Primer design