SecReT4
Protein ID: 21233879
T4SS name [ID]Tra_F [592]
Gene symbolorf217
Locus tagST585_p130
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]157503..158579 [+]
Productpilus biogenesis protein
Component typeTraU_F
UniProt IDQ8L271
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7.9e-64, Aligned region: 54..356
Protein Sequence: 358 a.a.     [Download]
>gi|21233879|ref|NP_640177.1| pilus biogenesis protein [Proteus vulgaris]
MRAKVSILKSTLVSAIAAACLTFSAGIMAADSPTETQAENESCRDNKVLSAKLFTDVCWSCIFPIKVAGA
TIGPSGSVPNDAATGSVCACADGLGVYHPGIMSALWEPRRFIELTRTPGCMSSLGGAKLNLGSELQYGTQ
TDSAKDERQRAAISFYNAHMYAMPLLRMLDLYLPGSCNADPYSDFDIISFTEIDPTWNNSALAFFQNPES
AAVANIVAQQACTVEAAAQFAGAQPQSALWWCAGSWGGQYPLTGSVRTMDTPRTTSLAATRQLAVEHRRG
LAYRSVGNDVACRAKIYPTIPKQQYKMNMFYPTPETKKGHNIGESPYKWQGGSFRYPTGMGQDSVYMIFQ
WTDCCRTL
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|21233663|ref|NC_003905.1|:157503-158579 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAGAGCAAAAGTATCGATTTTAAAATCAACATTAGTCTCTGCTATTGCTGCTGCCTGCCTCACTTTTT
CAGCTGGCATCATGGCTGCTGACAGCCCTACTGAAACACAAGCAGAGAATGAGTCATGCAGGGATAACAA
AGTCCTGTCTGCAAAACTGTTCACTGATGTGTGCTGGTCTTGCATCTTCCCCATAAAAGTCGCTGGCGCA
ACAATAGGCCCGTCTGGGAGTGTACCGAACGATGCAGCTACCGGATCAGTATGCGCTTGTGCTGATGGGC
TTGGCGTTTATCATCCCGGAATTATGTCAGCACTGTGGGAGCCTCGGCGCTTCATTGAGCTGACCAGAAC
GCCCGGCTGTATGTCCTCTCTCGGTGGCGCAAAACTGAATCTGGGCAGCGAACTGCAATACGGAACACAA
ACGGACAGTGCGAAGGATGAGCGCCAGCGTGCGGCTATCAGCTTCTATAATGCGCATATGTACGCCATGC
CTTTACTGAGAATGCTGGATTTGTACCTTCCGGGCAGCTGTAATGCTGATCCATACTCCGATTTCGATAT
CATTAGTTTCACGGAAATAGATCCGACTTGGAATAACTCTGCCTTAGCATTTTTCCAAAACCCTGAATCT
GCCGCTGTGGCTAACATTGTTGCTCAGCAAGCCTGTACCGTTGAAGCCGCTGCACAATTTGCCGGGGCAC
AGCCCCAGTCTGCCCTTTGGTGGTGTGCCGGGTCATGGGGAGGTCAATACCCTCTAACGGGCTCAGTCAG
GACTATGGATACTCCACGAACCACTAGCCTCGCGGCGACTCGACAACTGGCCGTGGAGCATCGCCGTGGG
CTTGCCTATCGCTCTGTGGGGAACGATGTAGCTTGCCGTGCAAAGATATACCCAACCATTCCAAAGCAAC
AATACAAAATGAATATGTTTTACCCTACACCAGAGACAAAAAAGGGCCACAATATCGGTGAGTCACCATA
TAAATGGCAAGGGGGATCATTCCGCTATCCGACCGGTATGGGACAGGATTCTGTGTATATGATTTTCCAG
TGGACAGATTGCTGCCGAACTCTTTAA
 Primer design