SecReT4
Protein ID: 21233902
T4SS name [ID]Tra_F [592]
Gene symbolorf240
Locus tagST585_p104
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]174795..175886 [+]
Productpilus biogenesis protein
Component typeTraF_F
UniProt IDQ8L264
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.3e-55, Aligned region: 56..296
Protein Sequence: 363 a.a.     [Download]
>gi|21233902|ref|NP_640200.1| pilus biogenesis protein [Proteus vulgaris]
MAYRRFIKTSLAVLVGCTVYSHSFLAVAAYGQEQEIKTSGDVYAGGKEFQKEKDQGWFWKKDPPMPVKEE
PVPAPEPEKKPDDEKEQDKQMPVAPPSPPSAQEEKKGPAPFSVVWFRENIQDIRDRAIDDPTPENVRAYL
LAQRIMLDKASRYKDMAQLISITDPIIDETGRRSTSSFGSLSQSVSAEENEKQVAREIGKKAGLFFFFKG
EGCKLCSQQASVMQTFSYLTNIPVIPISIDGHNLPGNPFPNVRVDDGQAKKLQIRNVPAIALAIPPDQTR
IVSFGPISADQLVKRTVLIAHDAGLVSDDSYKSTLPFNDNGYIDSDILKDMPEEYMQNPDQFIKYIQTKA
GYTPTDQSPPTKK
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|21233663|ref|NC_003905.1|:174795-175886 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGGCCTATAGACGTTTTATTAAAACATCCCTCGCCGTTCTTGTTGGATGTACCGTTTATTCTCACTCCT
TCCTCGCTGTGGCCGCTTATGGACAAGAACAGGAGATAAAGACCAGTGGTGATGTTTACGCTGGTGGTAA
AGAGTTTCAGAAAGAAAAGGATCAGGGCTGGTTTTGGAAGAAAGACCCGCCAATGCCGGTTAAAGAAGAG
CCTGTTCCAGCACCGGAACCAGAGAAAAAGCCGGATGACGAAAAAGAGCAAGACAAGCAAATGCCAGTTG
CTCCACCATCTCCACCATCTGCTCAGGAAGAGAAGAAAGGCCCAGCCCCCTTCTCAGTAGTCTGGTTCAG
AGAGAACATCCAAGACATTCGTGATAGAGCGATTGACGACCCGACACCTGAGAACGTCAGAGCATATTTA
CTGGCCCAGAGAATTATGTTGGATAAAGCCAGTCGGTACAAAGATATGGCTCAGCTGATATCGATTACTG
ACCCCATTATTGACGAAACAGGGCGACGCTCCACTTCCTCATTTGGCTCGCTGTCTCAATCAGTTTCAGC
AGAAGAAAATGAGAAACAGGTTGCTCGTGAAATTGGTAAAAAAGCGGGCCTGTTTTTCTTCTTCAAAGGT
GAAGGCTGCAAATTGTGCTCTCAACAGGCATCTGTTATGCAGACGTTCAGCTACCTTACCAATATCCCTG
TCATCCCCATATCGATTGACGGGCATAACCTTCCGGGTAATCCATTCCCGAATGTTCGTGTTGATGATGG
GCAGGCAAAAAAATTACAGATACGAAATGTGCCCGCCATTGCACTTGCTATCCCACCAGATCAAACCCGA
ATTGTATCGTTTGGCCCTATCAGTGCCGACCAACTGGTGAAACGAACAGTGCTAATTGCGCATGATGCGG
GCCTTGTCTCTGATGACAGTTACAAAAGTACGCTTCCGTTTAATGACAACGGGTACATCGACTCAGACAT
CCTGAAAGACATGCCGGAAGAGTACATGCAGAACCCAGACCAGTTTATTAAGTATATCCAGACGAAAGCC
GGATATACCCCTACCGATCAGAGCCCACCGACTAAAAAATAA
 Primer design