SecReT4
Protein ID: 21233903
T4SS name [ID]Tra_F [592]
Gene symbolorf241
Locus tagST585_p103
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]175900..177351 [+]
Productpilus biogenesis protein
Component typeTraH_F
UniProt IDQ8L263
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 9.4e-91, Aligned region: 44..404
Protein Sequence: 483 a.a.     [Download]
>gi|21233903|ref|NP_640201.1| pilus biogenesis protein [Proteus vulgaris]
MKIDTQKCKSSKSMKRSILSSLVLMAGLLSFTSNANADSINDQLNNMFGSMSNTTRPGDYHSVTRDGYTG
GGFTLRNKLRSLTPVNIQLPSAAGGCGGIDLFGGSFSFINADEFVQMLRNIAANASGLAFQLALNAMDAV
LDNAISRMQAVIQQMNDLTANSCQLAKGLLVDTAAAFGSEAKASVSAQLSSDGLSDQFDAFMGGMNGSKS
SPAKKEDAGKRVACKDYGNLMWCLLNNGQFTNQFLGSTDQQKEFIMSITGTYIVPKNISTDDTGNLIGGA
PILIAPLDTSDALEALVNGNTAFDIYKCTDTESCANPQTTTLAITGLAQKIIQFFDAEGYLSDVVAGTPL
TTSQLQKALFFNSIGASSNASSMAKYDINLATAYVKEIAPILAYSAANQYLRDMLTAAATSAKYEIDNNN
PAAESYAKTIVLISEARQRLADSYLAYTSKYGGESKIIELRDTFMKGIPVQKFEESQKPLSAQ
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|21233663|ref|NC_003905.1|:175900-177351 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAAAATAGATACACAGAAGTGCAAGTCTTCAAAAAGCATGAAGAGATCAATCCTGTCTTCGCTTGTCC
TCATGGCCGGACTTTTATCGTTTACATCAAATGCAAACGCAGACAGCATCAATGACCAGCTTAATAACAT
GTTTGGCTCGATGTCTAACACGACAAGGCCCGGTGACTATCACAGTGTCACCCGCGATGGATACACGGGG
GGAGGATTCACCCTACGTAATAAGCTCCGCTCCCTGACACCAGTCAATATTCAGCTGCCCAGCGCGGCTG
GTGGATGTGGTGGTATCGATCTGTTTGGTGGCTCCTTCTCATTTATCAATGCCGATGAGTTCGTTCAAAT
GCTGCGTAATATCGCGGCCAATGCCTCCGGCCTTGCTTTCCAGCTCGCCCTTAATGCGATGGACGCTGTT
TTAGATAACGCCATCTCCCGTATGCAAGCTGTCATCCAACAGATGAACGACCTTACAGCTAACTCTTGCC
AACTTGCCAAAGGTCTTTTGGTGGATACCGCTGCGGCCTTTGGGTCAGAAGCGAAAGCATCAGTTTCAGC
TCAATTATCATCAGATGGTTTAAGCGATCAGTTCGACGCATTCATGGGCGGTATGAACGGCAGTAAATCA
TCCCCTGCTAAAAAAGAAGATGCGGGTAAGCGAGTAGCTTGTAAGGACTATGGAAACTTAATGTGGTGCT
TGCTGAATAACGGGCAATTCACTAACCAGTTCCTCGGCTCTACGGATCAGCAAAAAGAGTTCATCATGTC
GATTACCGGTACGTACATCGTGCCAAAAAATATTTCGACGGATGACACCGGTAATCTCATTGGTGGTGCG
CCAATTCTAATCGCTCCGCTTGATACCTCTGATGCGCTTGAAGCATTGGTAAACGGTAATACAGCATTTG
ATATTTACAAATGCACTGATACTGAAAGCTGCGCAAATCCACAAACTACTACACTGGCTATCACTGGGCT
CGCGCAAAAGATAATCCAATTCTTTGATGCAGAGGGTTATCTTTCTGATGTTGTTGCCGGAACCCCACTA
ACAACGTCTCAGCTACAAAAAGCACTTTTCTTTAACTCTATTGGCGCTTCATCCAATGCCTCAAGCATGG
CTAAGTACGACATAAACTTAGCAACAGCTTACGTCAAAGAAATTGCCCCTATCCTTGCCTACTCCGCTGC
TAACCAGTATCTGAGAGATATGCTGACCGCTGCGGCAACCAGTGCAAAGTATGAAATTGATAACAATAAT
CCGGCTGCTGAATCCTACGCAAAAACAATTGTCCTGATTTCTGAAGCCCGCCAAAGGTTGGCCGATTCAT
ACCTTGCTTATACCAGTAAATACGGCGGTGAAAGCAAAATCATTGAGTTGAGGGATACATTTATGAAAGG
GATTCCTGTGCAAAAATTTGAAGAAAGCCAGAAACCACTCAGCGCACAGTAA
 Primer design