SecReT4
Protein ID: 21233904
T4SS name [ID]Tra_F [592]
Gene symbolorf242
Locus tagST585_p102
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]177361..180657 [+]
Productpilus biogenesis and aggregate stabilisation protein
Component typeTraG_F
UniProt IDQ8L262
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.9e-102, Aligned region: 5..479
Protein Sequence: 1098 a.a.     [Download]
>gi|21233904|ref|NP_640202.1| pilus biogenesis and aggregate stabilisation protein [Proteus vulgaris]
MSEWNIYTVGSVDFLYNVLNAIAMMMNSGLFSDIFRIAALLGVIGIVIASAISGGKTLSLGQMAVCVVMY
MCFFQVSTRVNLEDVTTGEFKAVDNVPFGLAAPASLISLIGYSITENMEQAFSTPAMTQYGALDPLFTMA
SLYDTMTTPMRWRMGSTTDKNLTKSIENYVRDCVISDIARGANTYSNIWRNSSGINSLTSSDFATYAVIE
DGKNSNGPFNNPRRASQYRCGDALTKVKDQLSEQATEVDTNMANTLKAIGRCTNCSASEKSLAMMSFYNQ
NSTSVRDFQLQMMMMPLILNVPVDAQFAAFKGNAAIARAQTQTQQSFQWSSSGSSFLYWMSSFMPIFQGI
IYALAPFMAFLIGLGVMGLRMILKYFLIIIWTQTWLPLAAVVNLYILTKLQSSTAAIMIVGLNNATGSTT
DISFNQMYDILVATQKHIALAGNLFALIPALGGFIVWGSSVAFNSLANSAAAPAPADTKTLAPDVTNAPA
LNSRHAEFSSSPMSGTTMTGASGVVGSISMQSIASENLSSANARREMASAQESAARNTMISKLASNQESG
SHSSAQNAAISSAIRQNFGSSADQIFNYMEAHGKTATDAISDLNTVSMGASAGLGTGSGPGVSAGVSGGA
TSASTDQHGNTIQGSKNASNSDAARLASSLGASFEKNLQGALNDVSTKTSQFGMSASDGSTYSNAYTNNQ
SAEKAYTEAQIFSQSTSSNQSMTFDVLGNKAATTPGLPEKMQQLINSEPGAAQRRDQYANQMQTNGLEGA
NALAAASVLALKDAGRLNEIAPELGFTSSGSPEITSTAATQNSSVGADAAQVSRNIKNIGGQTKAGASST
ESQARGFVDEQKSYTAPKATSARVGERFDNYISSDGPVQHDHNSNKANIEAQQHNSAYNIVADTPTSRSI
AREGLSLTNNLVSRLNDNPVIQETRRQAQEVNNAQGNGSQASNAIAEYYALGKAGVVGETLQQARDLALA
HVALDTGGTLSSNGQVIGGNREWGERALSMIDNTFEDQGRNDTNTLSTVTLGLHAASGRTLPSNTNSHTQ
GDSLTGARSNSQSSEQESGTGGSPGVNSEIRIEITEGVNGPNPNKRKI
 
Nucleotide Sequence: 3297 bp     [Download]
>gi|21233663|ref|NC_003905.1|:177361-180657 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAGCGAATGGAATATTTATACCGTTGGGAGCGTTGATTTTCTTTACAACGTTTTAAACGCGATAGCCA
TGATGATGAACAGTGGTCTATTTTCTGACATCTTTCGTATAGCTGCCCTGCTGGGCGTTATCGGTATCGT
CATCGCGTCTGCTATCTCTGGGGGGAAAACATTATCCCTTGGGCAAATGGCTGTGTGTGTTGTTATGTAT
ATGTGCTTCTTTCAGGTATCTACAAGGGTTAACCTCGAAGATGTGACCACGGGTGAGTTTAAAGCGGTGG
ATAACGTGCCTTTCGGCCTTGCTGCACCTGCCTCCCTGATTTCACTGATTGGTTATTCAATCACTGAGAA
TATGGAACAGGCTTTCTCTACCCCTGCCATGACTCAGTACGGCGCATTAGACCCATTATTTACGATGGCA
TCTCTTTACGACACGATGACGACGCCTATGCGCTGGAGGATGGGATCAACCACTGATAAAAACCTCACGA
AATCTATCGAAAACTATGTCAGAGATTGCGTTATCAGTGATATTGCGAGAGGCGCTAATACCTATTCAAA
TATCTGGAGAAACAGCAGTGGCATAAACTCTTTAACTTCTAGTGATTTTGCTACCTATGCTGTCATTGAA
GACGGTAAAAACTCAAATGGCCCCTTCAATAACCCACGCCGAGCTTCTCAATATCGGTGTGGAGATGCAC
TTACTAAGGTGAAAGATCAGCTTAGTGAGCAGGCCACAGAAGTTGATACGAATATGGCGAATACCTTGAA
GGCAATTGGCCGTTGTACAAATTGTTCAGCCTCTGAAAAATCACTTGCTATGATGAGTTTCTACAACCAA
AACTCTACCTCTGTCCGTGATTTTCAGCTTCAAATGATGATGATGCCGCTCATTTTAAATGTGCCGGTTG
ATGCTCAATTTGCAGCATTCAAAGGTAATGCAGCAATAGCCCGTGCTCAAACACAAACACAGCAGTCTTT
CCAGTGGTCATCGAGTGGCTCTTCATTCTTGTACTGGATGTCGTCATTCATGCCCATATTCCAAGGGATC
ATCTACGCCCTTGCCCCGTTCATGGCCTTCTTAATTGGTTTAGGTGTTATGGGGTTAAGGATGATTTTAA
AATACTTTTTAATCATCATATGGACTCAAACATGGCTACCCCTTGCAGCAGTCGTTAACCTGTATATTTT
GACAAAACTACAGTCTTCTACCGCTGCGATAATGATTGTAGGCTTAAATAATGCGACAGGTTCTACAACA
GACATCTCTTTCAACCAGATGTACGATATTTTAGTCGCCACACAAAAACATATTGCCTTGGCAGGTAACT
TGTTTGCATTAATCCCTGCCCTCGGCGGTTTCATTGTTTGGGGTAGCTCCGTTGCCTTTAACTCACTGGC
AAACTCAGCAGCAGCACCTGCACCAGCAGATACCAAAACGCTTGCACCTGATGTGACTAATGCCCCTGCG
TTAAACAGCAGACATGCTGAATTCTCCAGCTCTCCGATGTCGGGCACAACAATGACAGGTGCCTCTGGTG
TTGTCGGTTCAATTTCAATGCAATCAATTGCATCAGAAAACCTAAGCAGTGCTAATGCCAGAAGAGAAAT
GGCATCAGCTCAAGAATCAGCTGCACGTAACACCATGATAAGCAAGCTGGCATCTAACCAAGAGTCGGGA
TCCCATTCCTCTGCTCAGAATGCAGCTATTTCCTCTGCAATAAGACAAAATTTCGGAAGCTCTGCCGATC
AGATATTTAATTACATGGAAGCTCACGGAAAAACGGCTACTGATGCTATTTCTGATTTAAACACTGTTTC
TATGGGAGCATCCGCTGGTCTTGGTACTGGAAGTGGCCCCGGCGTTAGTGCCGGTGTTTCTGGGGGGGCA
ACAAGCGCTTCAACTGATCAGCATGGTAACACCATTCAAGGAAGTAAAAACGCTTCAAACAGTGATGCGG
CTCGCCTTGCCTCATCTTTGGGGGCTAGTTTTGAAAAAAATCTCCAAGGTGCTCTTAACGATGTATCAAC
AAAAACAAGCCAGTTTGGTATGTCTGCATCTGATGGGTCAACGTATTCAAACGCATACACTAATAATCAA
TCAGCTGAAAAAGCCTATACAGAAGCACAAATTTTCAGTCAATCCACATCCAGTAATCAATCTATGACCT
TTGATGTCCTTGGAAATAAAGCTGCAACTACTCCAGGTCTTCCTGAAAAAATGCAGCAGCTGATAAATTC
TGAACCGGGCGCGGCTCAAAGGCGTGATCAGTATGCAAATCAAATGCAAACTAACGGATTGGAAGGGGCT
AATGCTTTAGCGGCTGCATCTGTGCTCGCATTAAAAGATGCTGGTCGGTTGAATGAGATTGCTCCAGAAC
TTGGGTTTACTTCCTCTGGTAGCCCTGAGATAACTTCAACTGCCGCAACGCAGAACTCATCCGTTGGTGC
TGATGCTGCACAAGTAAGCAGAAACATCAAAAACATTGGAGGCCAAACTAAGGCTGGGGCCTCTTCTACT
GAGTCGCAAGCACGCGGATTCGTGGACGAACAAAAATCCTATACAGCTCCAAAAGCTACTTCTGCTCGCG
TAGGTGAACGTTTTGATAATTACATTTCATCTGATGGCCCGGTGCAACATGACCATAACTCCAATAAGGC
TAATATAGAAGCCCAACAGCATAACAGTGCATACAACATTGTTGCTGACACGCCTACTTCTAGGAGTATC
GCGCGTGAGGGGCTCAGTTTAACTAATAATCTTGTATCCCGTTTAAATGACAATCCTGTTATACAAGAAA
CTCGCAGGCAAGCTCAGGAAGTTAACAACGCACAAGGTAATGGCTCACAAGCTAGTAATGCTATTGCTGA
ATATTATGCGCTTGGTAAAGCTGGTGTCGTTGGTGAGACTCTTCAACAGGCTCGTGACTTAGCTTTGGCA
CATGTCGCGCTGGATACTGGTGGGACTCTATCATCTAATGGGCAAGTGATCGGTGGTAATCGCGAATGGG
GTGAGAGGGCATTATCTATGATTGACAACACTTTTGAAGATCAAGGTAGAAATGACACAAATACCCTTTC
AACAGTAACGCTTGGGCTCCATGCGGCAAGTGGTCGTACTTTACCTTCTAATACTAATAGCCACACTCAA
GGAGACTCTCTGACTGGTGCGAGGTCTAACTCTCAGAGTAGTGAACAAGAATCTGGCACTGGAGGCTCGC
CGGGTGTTAACTCTGAAATTCGTATAGAAATAACCGAAGGAGTAAACGGCCCAAACCCTAATAAACGTAA
AATCTAA
 Primer design