SecReT4
Protein ID: 21233906
T4SS name [ID]Tra_F [592]
Gene symbolorf244
Locus tagST585_p100
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]181127..183829 [+]
Productaggregate stabilisation protein
Component typeTraN_F
UniProt IDQ8L261
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.2e-79, Aligned region: 383..667
TraN [PF06986], Evalue: 3.2e-79, Aligned region: 743..819
Protein Sequence: 900 a.a.     [Download]
>gi|21233906|ref|NP_640204.1| aggregate stabilisation protein [Proteus vulgaris]
MNTLFRKRWFSVPICALSIISHVGLLSFTPYALAAESTAGAVSSNKKAQDAVNFYNTLPGISASGQGTVT
YGNGQSVDLNSIYPDQQGSSTSLDDLKKVYGEDSDTNKLGTSTGTTLSTENSLRGEAYRTVQSSSRTTTQ
LKDTDSIFNKHKDFLENQKEYMTLLGDCSTQTILDKKDTVNHIPDYRECTRTLDVSGQYHLYHPYVAGIL
SHNSGPANIQTCGEGCITLWVGTVGDDYWRGNCTIFEEEMSVKVKNAQAITSVKLTRAKWDDYMQVYVGG
TSKSDIVWAGPDGINVFPPETPGRCERNTSWDRNPNVDITEKFKQSNDDGVVHFKTRTSVTGAGEGYAKI
EIRFDVNKIVTNDIWEHPDQGYDKFVKAVEQGYCQSYSATCNDSIVPDSNGCATIDGVLVCADDFDAVPP
FGLSPFCRNALVTANCGADAGTNNTCKEFEKASCDFIRSSCLDGASGDTSGCWQASEVWDCGMDVVVPST
GSHEEYQCPGGVQCINGTCLAPTSEPSGDFATAAAMLQAATYAQNDLSCDTSTETNNDAAACEVFKGEAM
ECKSAMGGWVDCCNQPVDVSWLQYLQLTYYTLKVTDAVSVQAGVFEQGKGIFDMGSELASNAFDAIAKPA
ISAFDSLTGNAGSAVAEKVSDMGISSAINEGIGALTKQVAQWTLDTFGSGVTNMLFEAGASGAGSAAGGA
AVDSTGQMAANVQLSSTVMSAVSVVGYAYMAYQMANILVNIIWACTENEFKLAVKKETKLAIHIDSWCQT
KVLGQCIEKRSSYCAFNSQIGRIIQEQGRRQLGLNWGNNSKNPDCRGLTLDEFGKIDFNKIDLSEWIGSL
YEADLLPTPDDISLDSITGKGSVLNIDGTRKNSLERFESGIDGVDVQGTKETLKEKMRVK
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|21233663|ref|NC_003905.1|:181127-183829 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAATACACTTTTTCGCAAACGATGGTTCTCCGTTCCCATCTGTGCGTTATCAATCATCTCACATGTCG
GATTACTTAGCTTCACCCCGTATGCTCTGGCCGCAGAGAGCACGGCAGGAGCTGTGAGCTCAAACAAGAA
GGCTCAGGACGCAGTAAACTTCTATAACACCCTACCCGGAATTTCGGCCAGCGGGCAAGGAACCGTCACT
TATGGCAATGGGCAGTCGGTAGATCTCAATTCCATTTACCCTGACCAGCAAGGTTCATCAACATCCCTTG
ATGATCTGAAAAAAGTATATGGCGAAGACTCAGACACAAATAAGCTGGGTACATCAACCGGCACTACGCT
ATCGACAGAAAACTCATTGCGTGGCGAAGCCTACCGCACCGTGCAATCATCATCCAGAACAACTACCCAA
CTCAAAGATACGGACTCTATCTTTAATAAGCACAAAGACTTCCTCGAAAATCAGAAGGAGTACATGACGC
TATTGGGAGATTGTTCAACTCAAACGATACTGGATAAAAAAGATACTGTTAACCACATTCCTGACTACAG
AGAATGTACCCGCACCTTAGATGTGTCAGGCCAGTATCACCTTTATCATCCTTATGTGGCGGGTATACTT
TCACACAACAGCGGCCCAGCGAACATTCAAACCTGTGGCGAAGGTTGTATCACGCTATGGGTTGGTACTG
TTGGCGATGACTACTGGCGCGGAAACTGCACCATCTTTGAAGAAGAGATGTCTGTTAAAGTGAAAAATGC
CCAAGCTATCACGAGCGTAAAACTCACCCGCGCAAAATGGGATGACTACATGCAGGTCTATGTCGGTGGT
ACGTCTAAAAGCGATATAGTGTGGGCTGGCCCGGATGGCATTAACGTGTTCCCTCCTGAAACGCCCGGAA
GATGTGAAAGAAACACCAGCTGGGACAGAAATCCTAACGTCGATATAACTGAAAAGTTCAAGCAATCAAA
TGATGATGGTGTGGTTCACTTCAAAACCAGAACGTCTGTAACAGGAGCAGGCGAAGGCTACGCAAAAATA
GAGATTCGTTTTGACGTAAATAAAATCGTCACAAATGATATTTGGGAACACCCGGATCAGGGTTATGACA
AGTTCGTGAAAGCCGTCGAACAGGGTTACTGCCAATCGTATTCTGCTACCTGTAATGACAGTATCGTACC
TGACTCAAATGGCTGCGCAACCATTGACGGTGTGCTGGTGTGCGCCGATGACTTTGATGCCGTTCCTCCA
TTCGGTCTTTCTCCGTTTTGTCGAAATGCCCTTGTTACTGCAAACTGTGGTGCAGATGCCGGAACCAATA
ACACATGTAAAGAATTTGAGAAAGCCAGCTGTGATTTCATCCGTAGTTCATGCCTCGATGGCGCGAGTGG
AGACACAAGCGGATGCTGGCAGGCTAGTGAGGTATGGGATTGCGGTATGGACGTTGTTGTCCCTTCCACT
GGAAGCCATGAAGAATATCAATGTCCCGGTGGTGTTCAGTGCATAAACGGAACCTGTCTCGCTCCTACAT
CTGAGCCTAGCGGTGACTTTGCTACAGCAGCTGCAATGCTGCAAGCGGCCACCTATGCCCAGAACGACCT
TTCTTGTGATACCAGCACTGAAACAAACAACGATGCCGCAGCCTGTGAAGTCTTCAAGGGCGAAGCAATG
GAATGTAAATCGGCAATGGGCGGTTGGGTTGATTGCTGTAATCAGCCTGTTGATGTGAGCTGGCTTCAAT
ACCTGCAATTAACCTATTACACGCTGAAAGTTACTGATGCAGTGTCTGTACAGGCCGGGGTTTTTGAGCA
AGGGAAAGGTATTTTCGATATGGGGTCAGAGCTTGCAAGTAATGCTTTTGATGCCATCGCTAAGCCTGCT
ATCTCTGCATTTGACTCCCTTACGGGTAATGCTGGTTCAGCTGTAGCTGAAAAAGTGTCAGATATGGGAA
TATCATCTGCTATCAATGAAGGCATCGGCGCATTGACTAAACAAGTTGCACAGTGGACTCTTGATACCTT
CGGATCAGGTGTCACCAACATGTTGTTTGAAGCTGGTGCTAGTGGTGCTGGGTCTGCCGCTGGTGGTGCG
GCTGTGGATTCAACAGGACAAATGGCAGCAAATGTTCAGTTATCTTCCACCGTTATGTCTGCTGTTTCCG
TTGTTGGTTATGCCTACATGGCCTACCAAATGGCAAACATACTGGTCAACATCATATGGGCCTGTACCGA
AAATGAGTTCAAACTTGCTGTGAAGAAAGAGACAAAACTCGCCATTCATATAGACAGCTGGTGTCAGACT
AAAGTGCTTGGACAGTGTATAGAGAAACGTTCAAGCTATTGTGCTTTCAATTCCCAGATAGGGCGAATTA
TCCAAGAGCAAGGCCGTAGACAACTTGGTCTTAACTGGGGTAATAACTCTAAAAACCCTGACTGTAGGGG
GCTGACTCTCGACGAGTTTGGTAAAATCGACTTCAATAAAATCGACCTGTCAGAGTGGATCGGTTCACTT
TATGAAGCTGACCTGTTACCTACACCAGACGATATCAGTCTTGATAGTATCACTGGTAAGGGTAGCGTTT
TGAACATTGATGGTACACGCAAAAACTCGTTAGAGCGTTTTGAAAGTGGTATTGATGGTGTGGATGTGCA
AGGCACAAAGGAAACGCTTAAAGAAAAAATGAGAGTAAAATAA
 Primer design