SecReT4
Protein ID: 21233910
T4SS name [ID]Tra_F [592]
Gene symbolorf248
Locus tagST585_p096
StrainProteus vulgaris plasmid Rts1 (NC_003905)
Repliconplasmid Rts1 [GenBank: NC_003905] [Browse all T4SS(s) in this replicon]
Location [Strand]185699..186259 [-]
Producthypothetical protein
Component typeOrf169_F
UniProt IDQ8KJX4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 186 a.a.     [Download]
>gi|21233910|ref|NP_640208.1| hypothetical protein [Proteus vulgaris]
MKKLLIALCVVTGVTAIERPAEAAIVDLRNTAWEKFGRGECGLDPYLMYAIALWESKQRAGGGGWVAPSP
WALNNSVYGAYYPTSYEDAKKNLAKYMQATTVTDIGITQVNYRWNGHYVSKPEDLLDVETNIKVQAKILC
QAIKNNPDDIELAIGSYHTPNPKLRDKALNYARNVLRIWKRLIEND
 
Nucleotide Sequence: 561 bp     [Download]
>gi|21233663|ref|NC_003905.1|:c186259-185699 Proteus vulgaris plasmid Rts1 DNA, complete sequence
ATGAAAAAGTTGCTGATAGCCCTGTGTGTGGTAACAGGGGTTACGGCAATAGAACGTCCAGCTGAGGCGG
CTATTGTCGATCTGCGAAATACTGCATGGGAAAAATTTGGGCGGGGCGAATGCGGCCTTGACCCTTACCT
GATGTATGCTATTGCGTTATGGGAAAGTAAGCAAAGGGCTGGCGGGGGCGGTTGGGTTGCCCCGAGCCCG
TGGGCGCTTAACAATTCCGTTTACGGTGCATACTACCCAACAAGCTATGAAGATGCTAAAAAGAACCTCG
CTAAATACATGCAGGCTACCACTGTAACTGATATTGGCATCACGCAAGTTAATTACAGATGGAACGGTCA
CTATGTTTCAAAACCAGAAGATCTTCTGGATGTTGAAACCAATATTAAAGTACAAGCAAAAATCCTTTGC
CAAGCCATCAAAAATAACCCTGATGATATTGAACTGGCTATCGGGAGTTATCACACACCTAATCCAAAGC
TACGGGATAAAGCACTTAACTATGCCCGAAATGTTCTGCGAATCTGGAAGAGGTTAATTGAAAATGATTA
A
 Primer design