SecReT4
Protein ID: 21242988
T4SS name [ID]Tfc [750]
Gene symbolpilL
Locus tagXAC2253
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2637076..2637678 [+]
ProductPilL protein
Component typeTfc2
UniProt IDQ8PKC2
KEGG IDxac:XAC2253
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 200 a.a.     [Download]
>gi|21242988|ref|NP_642570.1| pilL gene product [Xanthomonas axonopodis pv. citri str. 306]
MPPPILPEPRSLGPTATLLALALLSGCTGAPLARHMAAPAASPASGVSTAPSFPAVPVVRQGRYTLVEIA
PIEGQRDLLMQTIDITLPTSDHATVQDGLQYLLRQSGYRLCPADADSAVLYALPLPAAHVHLGPTTLLTA
LLAMSGNAWILDVDEAHREVCFRRAESVGAATATPSTHPPDARMPPINAAPRHSPSEKLP
 
Nucleotide Sequence: 603 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2637076-2637678 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGCCGCCTCCTATCCTGCCCGAGCCCCGCAGCCTTGGCCCTACCGCCACCCTCCTCGCTCTGGCCTTGC
TGAGCGGCTGTACCGGTGCGCCGCTGGCGAGGCACATGGCGGCGCCGGCCGCATCGCCCGCTTCCGGCGT
CAGCACCGCACCGTCGTTCCCCGCGGTGCCCGTTGTCCGGCAGGGACGCTACACGCTCGTGGAGATCGCC
CCCATCGAGGGACAGCGCGACCTGCTGATGCAGACGATCGATATAACGCTACCCACCTCGGACCACGCCA
CCGTGCAAGACGGGCTGCAGTATCTCCTTCGGCAATCGGGCTACAGGCTGTGCCCGGCCGATGCCGACAG
CGCCGTTCTGTACGCGTTGCCTCTGCCCGCGGCCCACGTGCACCTGGGACCGACCACGCTCCTCACGGCC
CTTCTGGCGATGTCGGGCAACGCTTGGATTCTCGATGTAGACGAAGCCCATCGAGAGGTCTGCTTCCGCC
GCGCCGAGTCGGTCGGCGCTGCCACCGCGACGCCAAGCACTCACCCGCCCGATGCGCGGATGCCGCCGAT
CAACGCTGCGCCCCGCCATTCGCCCTCGGAGAAGCTGCCATGA
 Primer design