SecReT4
Protein ID: 21242990
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2255
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2638331..2639095 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDQ8PKC0
KEGG IDxac:XAC2255
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|21242990|ref|NP_642572.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MRAPGPSRTSRFVLLLAGSVCTLGASLPVHAQALRGETRIVESEARTTTDKRDNEARAREWNLRAEDWSR
YRTLMQGPLGTYSPNLDPLTALGIEARSDEERRRFAELQVQAEARRVQKTLDYQRAYDAAWQRLHPDLQR
VALPGGQAGGDVRGGTGAAEPGRLAVFVKEGCVACDQRVQQLQSAGTAMDVYVVGSRGDDKRIRRWARQA
AIEPAKVQAKAITLNHDGGRWLSLGVSGELPAVVREVGGQWQRQ
 
Nucleotide Sequence: 765 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2638331-2639095 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGCGAGCGCCCGGCCCATCCCGCACGTCCCGCTTTGTCCTGCTGCTGGCCGGATCGGTGTGCACGCTGG
GTGCAAGCCTGCCAGTCCATGCCCAGGCACTTCGAGGTGAGACCCGCATCGTCGAGAGCGAAGCACGCAC
AACCACGGACAAACGGGACAATGAGGCACGCGCCCGCGAGTGGAATCTGCGCGCCGAGGACTGGTCCCGC
TATCGCACGCTCATGCAGGGTCCGCTCGGCACGTATTCGCCGAACCTCGATCCGCTGACCGCGCTGGGCA
TTGAAGCGCGCAGCGACGAGGAACGCCGCCGCTTCGCCGAGCTGCAGGTGCAAGCCGAGGCACGGCGTGT
CCAGAAGACCCTGGACTATCAGCGCGCGTACGACGCGGCGTGGCAGCGCCTGCATCCGGACCTGCAGCGC
GTGGCCCTGCCGGGCGGCCAGGCGGGTGGCGACGTACGCGGCGGCACCGGTGCGGCGGAGCCTGGACGGC
TCGCGGTTTTCGTGAAGGAAGGCTGCGTTGCCTGCGACCAGCGGGTGCAACAGCTCCAGTCGGCCGGCAC
CGCCATGGATGTGTACGTGGTCGGCAGCCGCGGCGACGATAAACGCATCCGCCGCTGGGCACGGCAGGCG
GCCATCGAACCCGCGAAGGTGCAGGCCAAAGCCATCACGCTCAACCACGATGGTGGACGCTGGCTCTCGC
TGGGCGTGTCCGGTGAGCTGCCCGCGGTCGTGCGCGAGGTCGGCGGCCAATGGCAGCGCCAGTGA
 Primer design