SecReT4
Protein ID: 21242991
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2256
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2639080..2639691 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ8PKB9
KEGG IDxac:XAC2256
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 203 a.a.     [Download]
>gi|21242991|ref|NP_642573.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MAAPVKPPRGPLLGSGLAIAALAATCTAGTAWGQETPPPAYQIAAAQAGVPSAVLYAVALQESGTRLRGR
QIPWPWTLNVAGAPQRHATRADACLALRRALRGTPAQRIDVGLGQINAGYHAHRVAQPCALLDPYRNLAI
AAEILREQHTPGEDWITAIGRYHRPAGGPPATRYRGSVQRHLARVLGHPQATATLNGHRGSQP
 
Nucleotide Sequence: 612 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2639080-2639691 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGGCAGCGCCAGTGAAGCCGCCGCGCGGCCCGCTGCTCGGGTCCGGCTTGGCGATCGCGGCGCTCGCAG
CCACCTGCACCGCCGGCACCGCCTGGGGCCAGGAAACACCGCCGCCGGCCTACCAGATCGCGGCGGCGCA
GGCCGGGGTGCCCTCCGCCGTGCTGTACGCGGTCGCGCTGCAGGAAAGCGGTACGCGGCTGCGGGGCCGG
CAGATTCCCTGGCCCTGGACGCTCAACGTGGCGGGAGCTCCGCAACGCCACGCCACACGTGCCGATGCCT
GCCTCGCACTGCGCCGGGCCCTGCGGGGCACGCCCGCGCAGCGCATCGACGTCGGGCTGGGCCAGATCAA
CGCCGGCTACCACGCGCATCGGGTAGCGCAGCCCTGCGCGCTGTTGGACCCGTACCGCAATCTGGCCATC
GCCGCGGAGATACTGCGCGAGCAGCACACGCCCGGCGAGGACTGGATCACGGCGATCGGGCGCTACCACC
GACCCGCCGGCGGCCCGCCCGCCACGCGTTACCGCGGCAGTGTGCAACGCCATCTTGCGCGCGTGCTGGG
CCATCCACAGGCGACAGCCACATTGAACGGACATCGAGGCTCCCAGCCATGA
 Primer design