SecReT4
Protein ID: 21242992
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2257
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2639688..2640260 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDQ8PKB8
KEGG IDxac:XAC2257
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1e-49, Aligned region: 43..189
Protein Sequence: 190 a.a.     [Download]
>gi|21242992|ref|NP_642574.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MNTRAFHHWACATLLAAVCLSAAASRAQTAPPGPPPITALIVVEDRGGVPAQPYYDELGLPPRRPVSGMP
PASTPSSPTGHGEAALLPARSTLLSPGPVDARPLDAPGLQPFFLVGDDPRSRAWLRQRHGMLRGLQAAGL
VVNVESPQALDALRALAPGLALSPASGDDLARRLGLRHYPALLTATGIEQ
 
Nucleotide Sequence: 573 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2639688-2640260 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGAACACCCGCGCATTCCACCACTGGGCCTGCGCGACCCTGCTCGCCGCGGTCTGCCTGTCCGCCGCCG
CCTCGCGTGCGCAGACCGCCCCGCCCGGTCCGCCGCCGATCACCGCGCTGATCGTGGTCGAAGACCGTGG
AGGCGTCCCCGCGCAGCCCTACTACGACGAATTGGGACTGCCGCCGCGGCGTCCGGTTAGCGGCATGCCG
CCCGCATCCACGCCCTCTTCCCCGACGGGCCACGGGGAGGCTGCGCTGCTGCCCGCGCGTTCCACCCTGC
TCTCACCCGGTCCCGTCGATGCCCGCCCGCTCGACGCGCCGGGCCTCCAGCCTTTCTTCCTGGTCGGCGA
CGATCCACGCTCGCGCGCGTGGCTGCGTCAGCGCCACGGCATGCTGCGCGGCCTGCAAGCCGCCGGGCTG
GTGGTGAATGTGGAGTCGCCGCAGGCGCTGGATGCGCTGCGCGCCCTCGCCCCCGGTCTGGCGCTGTCGC
CCGCATCCGGGGACGACCTGGCACGCCGCCTGGGCCTTCGCCACTATCCGGCCCTGCTGACGGCCACTGG
CATCGAGCAGTGA
 Primer design