SecReT4
Protein ID: 21242994
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2259
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2640736..2642433 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDQ8PKB6
KEGG IDxac:XAC2259
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 9.5e-14, Aligned region: 349..459
TrwB_AAD_bind [PF10412], Evalue: 1.9e-09, Aligned region: 23..76
TrwB_AAD_bind [PF10412], Evalue: 1.9e-09, Aligned region: 349..488
AAA_10 [PF12846], Evalue: 1.4e-08, Aligned region: 32..426
Protein Sequence: 565 a.a.     [Download]
>gi|21242994|ref|NP_642576.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MRPLPPVGGLPHLHGIEPEEMDVTLPLGERVGHTLVLGTTRVGKTRLAELFITQDIRRRAADGGHEVVIV
FDPKGDADLLKRMYVEARRAGRESEFYVFHLGWPDLSAHYNAIGRFGRISEVATRIAGQLSGEGNSAAFR
EFAWRFVNIIARALVELGQRPDYLLIQRHVINIDALFMEYAAQFFAKTEPKAWEVIVQLEGRLNDKNIPR
NMIGREKRVIAIEQYLSQVRVYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKLTTGKVAQLLAPNYSDL
ADPRPIFDWMQIIRKRAIVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYKFGVDDGLPGANANSKVPI
NVHADEFNELMGDEFIPMVNKGGGAGVQVTAYTQTLSDIEARIGNRAKAGQVVGNFNNLVMLRVRETATA
ELLTRQLPKVEVFATSVMSGATDSSDPTGNTAFTSNTQDRIASTSVLMIEPAHVVALPKGQAFALMEGGN
LWKVRMPLPAPDPDEAMPRDLQELAAGMRLHYVEAGAWWDGQIAPGLQDATLPDDLLAGFAPPEDAGGNP
GAAAP
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2640736-2642433 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGCGCCCCTTGCCACCCGTGGGCGGCCTGCCCCATCTGCACGGCATCGAGCCCGAAGAGATGGACGTCA
CCCTGCCGCTGGGCGAACGGGTCGGCCACACGCTGGTGCTCGGCACCACGCGGGTCGGCAAGACCCGGCT
GGCCGAACTGTTCATCACGCAGGACATCCGCCGCCGCGCGGCGGATGGCGGGCACGAGGTGGTGATCGTG
TTCGATCCGAAGGGGGATGCGGACCTGCTCAAGCGGATGTACGTGGAAGCACGCCGCGCGGGACGCGAGA
GCGAGTTCTACGTGTTCCATCTGGGCTGGCCGGACCTGAGCGCGCACTACAACGCCATCGGCCGCTTCGG
CCGCATCTCCGAAGTCGCCACCCGCATCGCGGGGCAACTGTCCGGGGAAGGCAACAGCGCCGCTTTCCGT
GAGTTCGCGTGGCGGTTCGTCAACATCATCGCCCGCGCGCTCGTGGAACTGGGGCAGCGACCGGACTACC
TGCTGATCCAGCGGCACGTCATCAACATCGATGCGCTGTTCATGGAGTATGCGGCGCAGTTCTTCGCGAA
GACCGAACCCAAGGCCTGGGAGGTCATCGTCCAGCTCGAAGGCCGGCTCAACGACAAGAACATCCCGCGC
AACATGATCGGCCGCGAGAAGCGCGTGATCGCGATCGAGCAGTACCTCTCGCAGGTCCGCGTCTACGACC
CGGTGCTCGACGGCCTGCGAAGCGCCGTGCGCTACGACCGGACGTACTTCGACAAGATCGTCGCGAGCCT
GCTGCCGCTGCTGGAGAAGCTCACCACGGGCAAGGTCGCCCAGTTGCTGGCGCCGAATTACTCGGACCTC
GCCGATCCGCGGCCGATCTTCGACTGGATGCAGATCATCCGCAAACGCGCGATCGTGTACGTGGGACTGG
ACGCGCTCTCAGATGCGGAGGTGGCGGCCGCCGTGGGCAACTCGATGTTCTCGGACCTGGTCTCGGTCGC
GGGGCACATCTACAAGTTCGGCGTGGACGACGGCCTGCCGGGTGCGAATGCGAATTCCAAGGTGCCCATC
AACGTCCATGCCGACGAGTTCAACGAGCTCATGGGCGATGAATTCATTCCCATGGTCAACAAGGGCGGCG
GTGCCGGCGTCCAGGTCACGGCGTACACCCAGACGCTCTCCGATATCGAGGCGCGCATCGGCAATCGCGC
GAAGGCGGGACAGGTCGTGGGGAATTTCAACAACCTGGTCATGCTGCGGGTGCGAGAGACGGCCACGGCC
GAGCTGCTGACGCGCCAGTTGCCCAAGGTCGAGGTGTTCGCGACCTCGGTGATGAGCGGCGCCACGGACA
GCTCCGATCCCACGGGCAACACCGCGTTTACCTCGAACACCCAGGACCGCATCGCCAGTACCAGCGTGCT
GATGATCGAGCCCGCGCACGTAGTGGCGTTGCCGAAGGGCCAGGCCTTCGCGCTGATGGAAGGTGGCAAC
CTCTGGAAGGTGCGCATGCCGCTGCCCGCGCCCGATCCCGACGAGGCCATGCCGCGCGATCTGCAGGAGC
TCGCTGCCGGCATGCGGTTGCACTACGTCGAGGCGGGCGCATGGTGGGATGGACAGATCGCGCCAGGGCT
GCAGGACGCAACCTTGCCCGACGATCTACTGGCAGGTTTCGCGCCGCCGGAGGACGCAGGCGGAAACCCT
GGAGCTGCGGCGCCATGA
 Primer design