SecReT4
Protein ID: 21242995
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2260
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2642430..2643179 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ8PKB5
KEGG IDxac:XAC2260
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.9e-66, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|21242995|ref|NP_642577.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MSDVAATAQRQQVRQQGLILGLVTLPFRCFGVLCGSLFLCIVIECIGMALFWPDQGWRHAQAMLGHELDQ
LSDYFVRSALVQEPGRTAHQWIQHAYEWAFVRSGLLEWMQDASRQARAGASGRPWSLPQVLATVSMHAEG
YLIAAAYTVLLFLVRLLMLCLTLPLFALAAFVGLVDGLVRRDIRRFGAGRESGFLYHRARASLVPLAVLP
WVTYLALPVRVHPVVILLPSAVLLGVAVDIAAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2642430-2643179 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGAGCGATGTCGCCGCTACCGCGCAACGCCAGCAGGTCCGCCAGCAGGGACTGATCCTGGGTCTCGTCA
CCTTGCCCTTCCGTTGCTTCGGTGTGCTGTGCGGTTCGCTGTTCCTCTGCATCGTGATCGAATGCATCGG
GATGGCCCTCTTTTGGCCGGACCAGGGCTGGCGCCATGCGCAGGCGATGCTGGGCCACGAGTTGGACCAG
TTGTCTGACTACTTCGTTCGCAGCGCTCTGGTGCAGGAGCCGGGACGCACAGCGCACCAGTGGATCCAGC
ACGCCTACGAATGGGCGTTCGTGCGCAGCGGGCTGCTGGAGTGGATGCAGGATGCGTCGCGCCAGGCGCG
CGCGGGTGCCTCCGGCCGCCCATGGAGCCTGCCGCAGGTCCTGGCCACGGTATCCATGCATGCCGAGGGT
TACCTCATCGCCGCGGCCTACACCGTGCTGCTGTTCCTGGTGCGGCTGCTGATGCTATGCCTGACCTTGC
CGCTTTTTGCCCTGGCCGCGTTTGTGGGACTCGTGGATGGTTTGGTTCGCCGAGACATCCGGCGTTTCGG
AGCGGGACGCGAATCGGGATTCCTGTACCACCGGGCAAGGGCCAGCCTGGTGCCGCTGGCGGTGCTGCCC
TGGGTGACCTACCTGGCGTTGCCGGTCAGGGTGCATCCAGTGGTCATCCTGCTTCCCAGTGCGGTACTGC
TTGGGGTGGCTGTGGATATCGCGGCTGGCAGCTTCAAAAAATACCTGTGA
 Primer design