SecReT4
Protein ID: 21243004
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2269
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2654629..2655087 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ8PKA6
KEGG IDxac:XAC2269
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.4e-29, Aligned region: 48..131
Protein Sequence: 152 a.a.     [Download]
>gi|21243004|ref|NP_642586.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MGLASIESPHSPRRFDMTSRATASRAAPSRLPPSGVLAAALLWVTASAHAADPALERERLAGAVRLLAQV
ERVGFMPNTRAEDSADSTSSRYHFDYARLRDDVGRMQAGIAQYLAPRRAQPRDPSSLAGDYTRDPGGQSK
TQTKTQTRERSR
 
Nucleotide Sequence: 459 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2654629-2655087 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGGGCCTCGCCAGCATCGAGTCTCCCCACAGCCCAAGGAGATTCGACATGACCTCGCGTGCCACGGCCA
GCCGCGCCGCGCCCTCGCGCCTTCCCCCGTCCGGCGTGCTGGCCGCGGCACTTCTCTGGGTGACGGCATC
GGCGCATGCCGCCGATCCCGCGCTGGAGCGCGAACGGCTGGCGGGCGCGGTCCGCCTGCTCGCCCAGGTG
GAACGCGTGGGCTTCATGCCGAATACCCGCGCCGAGGATTCCGCAGATTCAACGTCTTCCCGATACCACT
TCGACTACGCGCGCCTGCGGGACGACGTGGGCCGCATGCAGGCGGGCATCGCCCAGTACCTGGCGCCGAG
GCGCGCGCAGCCGCGCGATCCGTCGTCCCTGGCCGGCGACTACACGCGCGATCCCGGCGGTCAGTCGAAG
ACCCAAACCAAGACGCAGACGCGGGAGCGATCGCGATGA
 Primer design