SecReT4
Protein ID: 21243005
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2270
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2655323..2655709 [+]
Producthypothetical protein
Component typeTfc10
UniProt IDQ8PKA5
KEGG IDxac:XAC2270
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 7e-34, Aligned region: 41..127
Protein Sequence: 128 a.a.     [Download]
>gi|21243005|ref|NP_642587.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MNRGSAMTVPNPFGRGAWRAACIAIATALPPVVSPAIAAGLPTMEDPSRGAGKGILQTLQNYGYDIVLLV
ALLVVASMFVGVCYHAYTRYSEIHTGRATWGQFGLTVAVGAMLLVVGIWLLTKATAIL
 
Nucleotide Sequence: 387 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2655323-2655709 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGAACCGAGGATCTGCCATGACCGTCCCCAACCCCTTCGGCCGCGGCGCATGGCGCGCCGCGTGCATCG
CGATCGCTACCGCGTTGCCGCCCGTCGTGTCTCCCGCCATCGCGGCCGGCCTGCCCACGATGGAAGACCC
CTCCCGCGGCGCCGGCAAGGGCATCCTGCAGACGCTGCAGAACTACGGCTACGACATCGTGCTATTGGTC
GCGCTGCTGGTCGTCGCCTCGATGTTCGTGGGCGTCTGCTACCACGCCTACACGCGTTATTCGGAAATCC
ACACCGGACGCGCGACCTGGGGCCAATTCGGCCTGACGGTGGCCGTGGGCGCGATGCTGCTGGTGGTGGG
CATCTGGCTGCTCACCAAGGCCACGGCCATCCTGTAA
 Primer design