SecReT4
Protein ID: 21243006
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2271
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2655714..2656127 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ8PKA4
KEGG IDxac:XAC2271
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.2e-50, Aligned region: 12..136
Protein Sequence: 137 a.a.     [Download]
>gi|21243006|ref|NP_642588.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MPMAPQDTARDGLVAFLPHRLNRQPVVVRGLTADELWVCAGLSAAAGLLAGLPLAWITRSIAMMPTMIVL
GVAAGVFVGGGLLRRKKRGRPDIWLYRQMQWRLALRFPHGTGRPGTHRLVTRSGYWTTRRTRPRGRP
 
Nucleotide Sequence: 414 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2655714-2656127 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGCCGATGGCGCCCCAGGACACGGCACGCGACGGCCTCGTCGCATTCCTCCCGCACCGCCTCAACCGCC
AGCCGGTGGTGGTGCGCGGGCTGACGGCCGACGAGCTCTGGGTCTGCGCCGGGCTGTCCGCCGCCGCCGG
CCTGCTCGCAGGCCTGCCGCTGGCCTGGATCACGCGCAGCATCGCGATGATGCCCACGATGATCGTCCTG
GGCGTCGCCGCGGGCGTGTTCGTCGGCGGCGGCCTCCTGCGCCGCAAGAAGCGCGGCCGGCCCGACATCT
GGCTGTACCGGCAGATGCAGTGGCGCCTGGCCCTGCGTTTCCCGCACGGGACGGGACGGCCCGGCACCCA
TCGTCTGGTGACGCGCAGCGGGTACTGGACGACACGCCGCACGCGGCCGCGGGGCCGGCCATGA
 Primer design