SecReT4
Protein ID: 21243008
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2273
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2657818..2659290 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDQ8PKA2
KEGG IDxac:XAC2273
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 490 a.a.     [Download]
>gi|21243008|ref|NP_642590.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MKSNGLLKWLMIPVAALLVFLGIHLTSGRSDQSAAGGGTAQLTPEEMKALGIDGDTPRDTVATLVAQVKQ
LRGELQTAMGDNKNQRAENERLRQRDSSIDQRIQSALDGERGRLLQEREQAVGDKQQTQGMLQELQHKLD
QLGGKGGSTDLPVGLGLEEGDGKGFGAQGAPGVRWVEPDDARPDAGKGPAGASGKGERFPMRFGPADGGT
PGGGSVSAPESKAGAEPKPAKPVFTVPTNATLMGSVAMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANG
IDLPEVAGAVVSGTASGDWTLSCVRGQIRSVTFVFRDGTIRTVPDEKGQGGTSGNRGNAGNGTAADGQGP
ILGGLGWISDPHGIPCVSGERRSNAQQYLGSQALITAAGAGAASLIKSDSGSVAVVSNGNGSLGTVGISG
NEAMGRILAGGVQEMSQWVNKLYGQAFAAVYVPPGAQVAVHLEQPLQIDHDAQGRKVRHATGGSHAIDLD
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2657818-2659290 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGAAAAGTAACGGCCTGCTCAAGTGGCTGATGATTCCCGTGGCAGCGCTGCTGGTCTTTCTTGGCATCC
ACCTCACGTCCGGACGCTCGGACCAGTCCGCCGCGGGCGGAGGCACCGCCCAGCTCACACCCGAGGAAAT
GAAGGCGCTCGGCATCGACGGCGACACGCCGCGCGACACCGTGGCGACGCTGGTCGCGCAAGTGAAGCAG
CTGCGCGGCGAATTGCAAACGGCCATGGGCGACAACAAGAACCAGCGCGCGGAGAATGAGCGACTTCGCC
AGCGCGACAGCTCCATCGACCAGCGCATCCAGTCCGCGCTCGACGGCGAGCGCGGCCGCCTGCTGCAGGA
ACGCGAGCAGGCGGTCGGTGACAAGCAGCAGACGCAGGGCATGCTGCAGGAACTGCAGCACAAGCTCGAC
CAACTCGGCGGCAAGGGCGGCTCCACCGACCTGCCGGTCGGCCTCGGCCTGGAGGAAGGCGACGGCAAGG
GCTTCGGTGCCCAGGGCGCCCCGGGCGTCCGCTGGGTGGAGCCCGACGATGCGCGTCCCGACGCCGGCAA
GGGCCCTGCGGGGGCTTCGGGAAAGGGGGAACGATTTCCGATGCGGTTCGGGCCGGCCGATGGTGGCACT
CCCGGCGGCGGCTCCGTATCGGCACCCGAATCCAAGGCCGGCGCGGAGCCTAAGCCCGCCAAGCCGGTCT
TCACGGTCCCCACGAATGCGACGCTCATGGGGTCGGTGGCGATGACGGCTCTGATCGGCCGCGTGCCCAT
CGACGGCACGGTGAACGACCCCTACCCGTTCAAGGTGCTCATCGGCCCCGACAACCTCACGGCCAACGGC
ATCGATCTGCCGGAAGTAGCGGGCGCCGTGGTGAGCGGCACGGCCTCCGGCGACTGGACGCTCTCTTGCG
TGCGCGGCCAGATCCGCTCGGTCACCTTCGTGTTCCGCGACGGCACCATCCGCACGGTCCCCGACGAGAA
GGGCCAGGGCGGCACCAGCGGCAACCGTGGCAACGCGGGCAACGGCACTGCCGCCGATGGACAGGGCCCG
ATCCTTGGGGGCCTCGGCTGGATCAGCGATCCGCACGGCATCCCCTGCGTGAGCGGGGAGCGGCGCAGCA
ACGCGCAGCAGTACCTGGGCTCGCAAGCGCTCATCACGGCCGCCGGGGCGGGCGCGGCTTCGCTCATCAA
GAGCGACAGCGGCAGCGTTGCGGTGGTGAGCAACGGCAACGGCTCGCTGGGCACCGTGGGCATCTCCGGC
AACGAGGCCATGGGCCGCATTTTGGCCGGTGGCGTGCAGGAGATGTCGCAGTGGGTGAACAAGCTCTACG
GCCAGGCCTTCGCCGCGGTGTACGTGCCGCCCGGCGCCCAGGTCGCCGTCCACCTCGAACAACCCTTGCA
GATCGACCACGACGCCCAGGGCCGCAAGGTCCGCCACGCTACCGGAGGAAGCCATGCGATCGACCTGGAC
TGA
 Primer design