SecReT4
Protein ID: 21243017
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2282
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2669258..2669647 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDQ8PK93
KEGG IDxac:XAC2282
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 9.1e-38, Aligned region: 15..126
Protein Sequence: 129 a.a.     [Download]
>gi|21243017|ref|NP_642599.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MAGLALQLATTAFAADVQVFTDRAHPVAAAPGTTVVELDAPARLIAELGADLPADPRRAESLLRQRLASP
KQRDLQSRIAQAYQRVADAYHLGVAKLPAVVVDGRYVVYGDANVGRAVARIAGHRNARP
 
Nucleotide Sequence: 390 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2669258-2669647 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
TTGGCAGGCCTGGCTTTGCAGCTCGCCACCACCGCGTTCGCCGCCGATGTTCAGGTGTTCACCGACCGTG
CCCATCCGGTCGCCGCGGCCCCTGGCACGACCGTCGTTGAACTGGACGCCCCCGCACGCCTGATCGCCGA
GCTCGGCGCGGACCTGCCGGCCGATCCCCGGCGCGCAGAATCCCTGCTGCGCCAGCGCCTGGCGTCTCCA
AAGCAGCGGGACTTGCAATCGCGGATCGCCCAGGCGTACCAGCGCGTGGCCGACGCGTACCATCTGGGCG
TCGCCAAGCTCCCCGCGGTGGTGGTCGATGGGCGTTACGTCGTCTATGGCGACGCGAACGTGGGGCGCGC
CGTCGCCCGCATTGCCGGTCACCGGAATGCCCGGCCATGA
 Primer design