SecReT4
Protein ID: 21243018
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2283
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2669644..2670576 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDQ8PK92
KEGG IDxac:XAC2283
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 8.6e-92, Aligned region: 32..299
Protein Sequence: 310 a.a.     [Download]
>gi|21243018|ref|NP_642600.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MMGLRKLRGTVACVLLASTGPSFALNTASIVTAALSPDCLAYRIAGICYWLYCTSSGCTVRTSVKVRHYV
PDAVVSSYSNTGANPWVEVRAMSTPNPTAQAGGDGTTNEEHENNLAKFKNADVIGHPAGAVFSAFASRSG
YTCEGAGTPFVPYLLSTFDTLAWRYNVPEAAYPESLTPGVREIGSRLTANLWGNVYPRGGFLHQTHDYWS
GAVVAQRAGDVVTRTGQPHVYQPLLASSYAGYWPAGPLVESNPDSGKWQELTPTLSSRCAVFPHSGPFVQ
AQQGDYAWALWRPYSCCQRRGQVFLGSVDF
 
Nucleotide Sequence: 933 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2669644-2670576 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGATGGGCCTGCGCAAACTCCGAGGGACCGTCGCCTGCGTTCTGCTGGCGAGCACCGGACCGTCCTTCG
CGCTCAACACGGCGAGCATCGTGACCGCTGCCCTGTCGCCCGACTGCCTGGCCTATCGCATCGCGGGCAT
CTGCTACTGGCTCTACTGCACATCGAGCGGCTGCACCGTCCGCACGTCGGTCAAGGTACGGCACTACGTC
CCGGATGCGGTCGTCTCCAGCTACAGCAACACCGGGGCCAACCCCTGGGTCGAAGTGCGCGCCATGAGTA
CGCCCAACCCCACCGCCCAGGCCGGCGGCGACGGCACGACGAACGAGGAGCATGAGAACAACCTTGCCAA
GTTCAAAAACGCCGACGTGATCGGCCATCCGGCGGGCGCCGTTTTCAGCGCATTCGCCAGCCGCTCGGGA
TACACCTGCGAGGGGGCGGGAACGCCGTTCGTTCCCTACCTGCTCAGCACGTTCGACACGCTGGCCTGGC
GGTACAACGTGCCGGAGGCGGCGTACCCCGAATCGCTCACGCCCGGCGTGCGGGAAATTGGCTCGCGGCT
CACGGCCAACCTGTGGGGCAACGTCTATCCACGGGGTGGCTTCCTGCACCAGACCCACGACTACTGGAGC
GGCGCCGTGGTTGCGCAACGGGCCGGGGACGTGGTGACGCGCACCGGGCAGCCCCACGTGTACCAGCCGC
TGCTCGCGAGTTCCTATGCAGGCTATTGGCCCGCCGGGCCGCTGGTGGAGAGCAATCCCGATTCGGGCAA
GTGGCAGGAGCTGACCCCTACCCTGTCGAGCCGCTGCGCGGTGTTTCCGCATTCCGGGCCCTTCGTGCAG
GCGCAGCAGGGCGACTACGCCTGGGCGCTCTGGCGCCCGTACAGCTGCTGCCAGCGGCGCGGCCAGGTCT
TCCTCGGCAGCGTGGATTTTTGA
 Primer design