SecReT4
Protein ID: 21243019
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2284
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2670745..2671989 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ8PK91
KEGG IDxac:XAC2284
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 414 a.a.     [Download]
>gi|21243019|ref|NP_642601.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MLYSIGGGRAVSMGPAGNMQSIGVGVGWNSNLICGDMSITTTLRNQLNGVTNGFQSIMSNVIQSATSAVA
SLPALIIQRADPGLYNLLTNGILQARLDFDRSKMTCRAIAGRMADMAGGQTGWDQLAEGMALKQAVSSTD
AVSAIERAEGNKGNSGVPWVGGSSAGGSGQSPIRVVGDVTRAGYNLLNGRNATDTSSIAASACNGRLTCQ
TWSSPQAAATWATRVLGEREQRTCQTCTKTLTTPGVGLTPLIQEEYEVKLKALQELVTGAKPTTAANLDA
AGSASLPLTRAVIEALRDEPDQDLLGKRLASEVALASVMEKALLLQRTLLTGRKEPNVAANELATKAVDQ
ESGALEQEIQNLKTELELRRELAGNSPMTLIQRYSTRAAGSRGIYQGDPTRDRLQEIQKPRSNP
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2670745-2671989 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGCTCTACAGCATCGGCGGCGGCCGGGCGGTGTCGATGGGGCCTGCGGGGAACATGCAAAGCATCGGGG
TCGGCGTGGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCACGACCACGCTGCGGAACCAGCT
CAACGGGGTCACGAACGGCTTCCAGTCGATCATGAGCAACGTGATCCAGAGCGCCACCAGCGCCGTGGCC
TCGCTGCCAGCGCTCATCATCCAGCGGGCCGATCCCGGCCTCTACAACCTGCTGACCAACGGCATCCTGC
AGGCCCGTCTGGACTTCGACCGCTCCAAGATGACTTGCCGCGCGATCGCCGGGCGCATGGCGGACATGGC
CGGTGGTCAGACCGGTTGGGATCAACTCGCGGAAGGCATGGCGCTCAAGCAGGCGGTTTCCAGCACAGAC
GCCGTCTCAGCGATCGAACGCGCCGAAGGCAACAAGGGCAACAGCGGCGTTCCCTGGGTGGGCGGTAGTA
GTGCCGGCGGATCGGGCCAGTCGCCGATCAGGGTCGTGGGCGACGTGACGCGCGCCGGCTACAACCTGCT
GAACGGACGCAATGCCACGGACACGTCCTCCATCGCCGCCAGCGCATGCAACGGACGCCTGACCTGCCAG
ACATGGTCCTCGCCCCAGGCCGCGGCCACCTGGGCGACCCGGGTGCTGGGCGAGCGCGAACAGCGCACGT
GCCAGACGTGCACCAAGACCTTGACCACGCCCGGGGTGGGCCTCACGCCGCTGATCCAGGAAGAGTACGA
GGTCAAGCTGAAAGCGCTGCAGGAACTCGTGACCGGTGCGAAGCCAACGACTGCGGCGAACCTGGACGCG
GCCGGTAGCGCCTCCCTGCCGCTCACGCGCGCTGTGATCGAGGCGCTGCGCGACGAGCCCGACCAGGATC
TGCTGGGCAAGCGGCTGGCGTCGGAGGTCGCGCTCGCCAGCGTGATGGAGAAGGCTCTGCTGCTGCAGCG
CACGCTGCTGACTGGCCGGAAGGAACCCAACGTCGCCGCCAACGAACTGGCAACCAAGGCCGTGGACCAG
GAAAGCGGCGCGCTGGAACAGGAGATCCAGAACCTCAAAACCGAGCTTGAGCTGCGGCGCGAACTCGCCG
GCAACTCGCCGATGACCTTGATCCAGCGCTACAGCACGCGTGCAGCCGGCTCGCGCGGAATTTACCAGGG
CGACCCTACCCGGGACCGCTTGCAGGAGATCCAGAAGCCGCGGAGCAACCCATGA
 Primer design