SecReT4
Protein ID: 21243349
T4SS name [ID]VirB [392]
Gene symbolvirB11
Locus tagXAC2618
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]3083345..3084385 [-]
ProductVirB11 protein
Component typeVirB11
UniProt IDQ8PJB7
KEGG IDxac:XAC2618
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.6e-62, Aligned region: 28..325
Protein Sequence: 346 a.a.     [Download]
>gi|21243349|ref|NP_642931.1| virB11 gene product [Xanthomonas axonopodis pv. citri str. 306]
MTIDDSPTARISNDFLDYQYSVLGILDYLNSPDVTEICINRPGELYLETIHGWQRVDVPSLTYDRARQFC
TAVVNESNTGQRITDADPVVSLTFPTGQRAQFVMPPACDAGKVSITIRLPSKHTKSLEQYKHDGFFDEVL
EQSADVSDHDQELLELRRKRDYAEFFKKCVLYKKNVVVAGATGSGKTTFMKALVNHIPNEERLVTIEDAR
ELFISQPNAVHLLYSKGGQSASNVTAKSCMEACLRMKPDRIILAELRGDESFYFIRNCASGHPGSITSCH
AGSVEQTWDQLALMVKASNEGSGLEFEVIKRLLRMTIDIVVHIKAHAGRRFITGIDFDPLRTLRGG
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c3084385-3083345 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGACGATCGATGACTCCCCGACAGCGCGTATTTCCAATGACTTTCTGGATTACCAGTACTCCGTGCTGG
GAATTCTGGACTATCTGAATTCGCCTGACGTGACCGAAATTTGCATCAATCGTCCTGGTGAGCTGTACCT
GGAGACGATCCATGGATGGCAGCGAGTCGACGTGCCATCCCTCACCTACGACCGCGCTCGGCAGTTCTGT
ACGGCGGTCGTCAATGAGAGCAACACCGGGCAACGCATCACCGATGCCGACCCTGTCGTATCGCTAACGT
TTCCGACCGGGCAACGTGCGCAGTTCGTGATGCCTCCTGCCTGCGATGCGGGCAAGGTGTCCATCACGAT
CCGACTTCCTTCGAAGCACACAAAGTCGCTTGAGCAGTACAAGCACGACGGTTTCTTCGACGAAGTGCTT
GAGCAATCGGCGGATGTCAGCGATCACGACCAGGAACTGCTTGAGCTGCGCCGCAAGCGCGATTACGCAG
AGTTTTTCAAGAAGTGCGTGCTTTACAAGAAAAATGTCGTTGTTGCCGGGGCGACAGGTAGCGGCAAAAC
GACCTTCATGAAGGCGCTGGTCAACCACATTCCGAACGAAGAGCGCCTGGTGACGATTGAGGACGCCAGG
GAGTTATTCATTAGTCAGCCGAACGCTGTGCACCTGCTTTATTCCAAGGGCGGTCAAAGCGCCAGCAACG
TGACTGCTAAGAGCTGCATGGAGGCCTGCCTGCGTATGAAGCCAGACCGCATCATCCTTGCCGAGTTGCG
CGGCGATGAGTCGTTCTACTTCATTCGTAACTGCGCGTCGGGCCATCCTGGCTCCATCACCAGTTGCCAT
GCCGGAAGTGTTGAGCAGACCTGGGACCAGCTTGCGTTGATGGTGAAGGCCTCCAATGAGGGCTCCGGTC
TGGAGTTCGAGGTGATCAAACGTCTGTTGAGAATGACCATCGACATCGTGGTTCACATCAAGGCGCACGC
TGGACGGCGCTTCATCACGGGTATCGATTTCGATCCTCTTCGCACCCTGCGCGGCGGCTAG
 Primer design