SecReT4
Protein ID: 21243352
T4SS name [ID]VirB [392]
Gene symbolvirB8
Locus tagXAC2621
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]3086330..3087376 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ8PJB4
KEGG IDxac:XAC2621
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.8e-56, Aligned region: 26..246
Protein Sequence: 348 a.a.     [Download]
>gi|21243352|ref|NP_642934.1| virB8 gene product [Xanthomonas axonopodis pv. citri str. 306]
MTDLDMLRKKVSEKDGSAQVGAAVQKAVNYEVSIADLARRSEKRAWIVATLSMLVTVMTAGGYYYMLPLK
EKVPYLVMADAYSGTSTIAKLEPNFGGRAISTSEALARSNIARFIIARESFDLSIIGQRDWNTVSAMGST
NVVSEYRALHSANNPSRPLNSYGKLRAIRVNILSITLIGGNGKAYTGATVRFQRTVYDKNSTVSTLLDNK
IATMGFVYQDNLEMSDSLRVENPLGFRVTDYRVDNDYSALPVAPAAGAVINAQPQAAVQQQVMQQPMPGM
ADPNAAGAAIAPQAGVPLQQGMQQQGGAPQQQAQPAFPDQMQPAGQLQAQPAMQPQGMPKNVNGASGR
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c3087376-3086330 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
GTGACGGATCTAGACATGTTGCGTAAGAAGGTCAGTGAAAAGGACGGTTCCGCCCAAGTAGGCGCGGCCG
TTCAAAAAGCGGTGAATTACGAGGTCAGCATTGCCGACCTCGCGCGCCGCAGCGAAAAGCGTGCCTGGAT
CGTGGCGACCCTGTCGATGCTCGTCACCGTCATGACAGCGGGCGGCTACTACTACATGCTGCCGCTGAAG
GAGAAAGTGCCGTATCTCGTCATGGCAGATGCGTATTCGGGTACTAGCACCATCGCCAAGCTTGAGCCCA
ACTTCGGTGGTCGAGCAATCAGCACCAGCGAGGCGCTGGCGCGTAGCAATATCGCGCGTTTCATTATTGC
GCGTGAGTCGTTTGATCTCTCCATCATTGGTCAGCGTGACTGGAACACGGTCTCGGCAATGGGGTCGACA
AATGTAGTGAGCGAATATCGCGCGCTGCACTCCGCCAACAACCCGTCGAGGCCGCTGAATTCGTACGGCA
AGCTCCGTGCAATTCGCGTCAATATCTTGAGTATTACCTTGATTGGCGGCAACGGGAAGGCATATACCGG
GGCAACCGTGCGCTTCCAGCGAACCGTTTATGACAAGAACTCCACGGTTTCGACGCTGCTGGACAACAAG
ATCGCCACGATGGGGTTCGTCTACCAGGATAATCTTGAGATGAGCGATAGCCTGAGGGTGGAAAATCCTC
TGGGCTTTCGGGTCACTGATTACCGCGTGGATAATGATTACTCCGCGCTGCCCGTTGCCCCAGCGGCTGG
CGCGGTTATCAATGCTCAGCCTCAGGCAGCAGTGCAGCAGCAGGTCATGCAGCAGCCGATGCCTGGGATG
GCCGATCCAAATGCGGCAGGTGCCGCCATTGCACCTCAAGCGGGCGTTCCGCTGCAACAAGGCATGCAGC
AACAAGGTGGCGCGCCTCAGCAACAGGCGCAGCCAGCATTTCCTGATCAAATGCAGCCGGCCGGTCAGCT
GCAAGCGCAGCCTGCAATGCAACCCCAAGGGATGCCCAAGAATGTCAATGGAGCAAGTGGTCGATGA
 Primer design