SecReT4
Protein ID: 21243354
T4SS name [ID]VirB [392]
Gene symbolvirD4
Locus tagXAC2623
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]3088230..3089903 [-]
ProductVirD4 protein
Component typeVirD4
UniProt IDQ8PJB2
KEGG IDxac:XAC2623
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.2e-111, Aligned region: 122..550
TraG-D_C [PF12696], Evalue: 1.6e-28, Aligned region: 398..511
TrwB_AAD_bind [PF10412], Evalue: 5.4e-25, Aligned region: 182..517
Protein Sequence: 557 a.a.     [Download]
>gi|21243354|ref|NP_642936.1| virD4 gene product [Xanthomonas axonopodis pv. citri str. 306]
MSKPKIIAIATLVAVLAGYCLSGYLTLLLLRLDTGLYGWDTYYRYFSALGLPQVAPYATKIKIAGVLGFG
LPVLVWAIAVVLIVKPKARALHGDARFAGAADLSKHGLFKPSGNGIVVGKFNGKLVRLSGQQFVILAAPT
RSGKGVGVVIPNLLEYQESVVVLDIKQENFDLTSGWRASQGHEVFLFNPFAEDRRTHRWNPLTYVSNDPA
FRVSDLMSIAAMLYPDGSDDQKFWVSQARNAFMAFALYLFENWDEELSLGFPGGAGAPTLGGIYRLSSGD
GTDLKKYLKSLSERRFLSSNAKSAFANLLSQADETFASIMGTLKEPLNAWINPVLDAATSADDFVLTDLR
KKKMTIYIGIQPNKLAESRLIINLLFSQIINLNTRELPKSNPELKYQCLLLMDEFTSIGKVDIIATAVAY
MAGYNIRLLPIIQSMAQLDATYGKDLSRTIITNHALQILYAPREQQDANDYSEMLGYTTIKKKNVTRGRE
TTHSVSEERRALMLPQELKAMGNEKEVFLYEGIPHPVKCDKIRYYEDRHFTARLLPKTEVKTLTIRM
 
Nucleotide Sequence: 1674 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c3089903-3088230 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGTCCAAACCCAAAATCATCGCAATTGCCACGCTGGTGGCGGTTCTAGCCGGATATTGCCTGTCCGGCT
ATCTGACCCTGCTGTTGCTGCGGCTCGACACCGGTCTGTACGGGTGGGACACCTACTACCGCTATTTCAG
CGCGCTTGGGTTGCCCCAAGTGGCGCCTTACGCGACCAAGATCAAGATTGCGGGCGTGCTTGGATTCGGG
CTGCCGGTGCTGGTCTGGGCGATTGCCGTTGTGCTCATCGTCAAGCCCAAGGCGCGCGCCCTGCACGGTG
ACGCGCGCTTCGCCGGCGCCGCCGATCTCTCCAAGCACGGGCTGTTCAAGCCCAGCGGAAACGGCATCGT
CGTCGGCAAGTTCAACGGCAAGCTGGTGCGATTGAGCGGCCAGCAATTCGTGATTCTTGCTGCACCGACG
CGCTCGGGTAAGGGCGTCGGTGTCGTCATCCCGAACCTCTTGGAGTATCAAGAGTCGGTCGTGGTCCTGG
ACATCAAGCAGGAGAACTTCGACCTGACCAGTGGCTGGCGTGCCAGCCAGGGCCACGAGGTCTTCCTGTT
CAATCCGTTCGCCGAAGACCGTCGCACGCATCGCTGGAATCCATTGACCTATGTGTCGAACGATCCCGCA
TTTCGCGTTTCGGATTTGATGAGCATCGCAGCGATGTTGTACCCGGACGGATCCGACGACCAGAAGTTCT
GGGTGAGCCAGGCGCGCAACGCCTTCATGGCGTTCGCGTTGTACCTGTTCGAAAACTGGGACGAGGAGCT
CTCGCTCGGTTTTCCGGGTGGGGCAGGAGCACCCACCTTGGGCGGAATTTATCGCCTTTCGTCGGGTGAC
GGCACCGATCTCAAGAAATATCTGAAGTCGCTGTCCGAGCGGCGGTTCCTCAGCAGCAACGCCAAGTCGG
CCTTTGCCAACCTGCTGTCACAGGCGGATGAGACCTTCGCCTCGATCATGGGCACCTTGAAGGAGCCGCT
CAATGCGTGGATCAATCCGGTTCTGGACGCTGCAACCAGTGCGGACGACTTCGTGCTCACGGACCTTCGC
AAGAAGAAGATGACCATCTACATCGGCATCCAGCCCAACAAGCTGGCCGAAAGCCGCCTGATCATCAACC
TGCTCTTCAGCCAGATCATCAACCTCAACACCCGCGAACTGCCCAAATCCAACCCCGAGCTCAAGTACCA
GTGCCTGCTGCTGATGGACGAATTCACCTCGATCGGCAAGGTGGACATCATCGCGACCGCGGTAGCCTAC
ATGGCCGGCTACAACATCCGCCTGCTGCCCATCATCCAAAGCATGGCCCAGCTGGACGCGACCTACGGCA
AAGATCTGTCACGCACCATCATCACCAATCACGCCCTGCAGATCCTTTACGCACCACGCGAACAGCAGGA
CGCCAACGACTATTCCGAGATGCTGGGATACACCACCATCAAGAAGAAGAACGTCACCAGAGGGCGGGAG
ACCACCCATAGCGTGTCAGAAGAACGCCGGGCGCTGATGTTGCCGCAGGAGCTCAAGGCGATGGGCAATG
AAAAGGAAGTGTTCTTGTACGAGGGAATCCCGCACCCGGTGAAGTGCGACAAGATCCGCTACTACGAGGA
TCGCCACTTCACTGCGCGCTTGTTGCCGAAAACCGAAGTGAAGACGCTTACCATCAGAATGTGA
 Primer design