SecReT4
Protein ID: 21264258
T4SS name [ID]VirB [361]
Gene symboltrwB
Locus tagXACb0030
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]26776..28350 [+]
ProductTrwB protein
Component typeVirD4
UniProt IDQ8PRK2
KEGG IDxac:XACb0030
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.2e-124, Aligned region: 127..510
TraG-D_C [PF12696], Evalue: 7.6e-20, Aligned region: 368..490
T4SS-DNA_transf [PF02534], Evalue: 1.8e-19, Aligned region: 288..512
AAA_10 [PF12846], Evalue: 5.5e-10, Aligned region: 140..447
FtsK_SpoIIIE [PF01580], Evalue: 2.8e-05, Aligned region: 119..178
Protein Sequence: 524 a.a.     [Download]
>gi|21264258|ref|NP_644758.1| TrwB protein [Xanthomonas axonopodis pv. citri str. 306]
MQKHEVESATLLFGVGLPLAGWLAGTYIGNVPLSPFPQALTAALHATPNNPFIVGGVVAGLALAASAAYL
FHEYGDDGFRGAPYRRWMRGSKMANWHKVKSQVNAANRGENRRRRAEQRGAKDLPPVMIGPIPMPLHLEN
RNTLICASIGAGKSVAMESMISSAVKRRDKMAVIDPNGTFYSKFSFPGDTILNPFDRRSSGWTLFNEIKG
VHDFDRMAKSVIPPQIDPSDEQWCAYARDVLADTMRKLVETNNPDQDTLVNLLVREDGEVIRAFLVNTDS
QGYFRDNAEKAIASIQFMMNKYVRPLSFMTKGDFSLHKWVNDPNAGNLFVTWREDMRAAQRPLVATWIDT
ICATILSISDDAQHLSRRLWLFLDELESLGRLESFVPAATKGRKHGLRMAASIQDWAQLDETYGKDAAKT
LLGCFRNYLIFGASNALNADKASEILGKQHVERIQITTNAGGIGGGGRSRHVIASPPEPVVLDSEISNLK
DLEGYVMFAEDFPIAKIKLPYVKYPHRAAAIDIK
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|21264228|ref|NC_003922.1|:26776-28350 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGCAGAAGCACGAAGTCGAAAGCGCAACCTTGCTCTTTGGTGTTGGCCTGCCGCTGGCCGGCTGGCTGG
CCGGCACATACATCGGCAATGTGCCGCTGTCGCCGTTCCCGCAAGCGCTCACCGCTGCGCTACACGCGAC
ACCGAACAATCCGTTCATCGTCGGCGGGGTTGTGGCCGGTTTGGCACTGGCCGCGAGCGCCGCGTATTTG
TTCCACGAGTACGGGGACGATGGTTTCCGGGGCGCGCCGTATCGCCGCTGGATGCGTGGCTCAAAGATGG
CGAACTGGCACAAGGTAAAGAGCCAGGTCAACGCGGCCAATCGCGGGGAGAATCGCCGCCGACGGGCCGA
ACAGAGGGGTGCGAAAGATTTGCCGCCCGTCATGATCGGCCCCATACCCATGCCGCTGCACCTTGAAAAC
CGTAACACGCTGATTTGCGCGTCCATCGGCGCGGGTAAGTCGGTCGCGATGGAAAGCATGATTTCGTCGG
CCGTGAAACGGCGCGACAAGATGGCCGTGATCGACCCGAACGGGACGTTCTACTCGAAATTCAGCTTTCC
CGGCGACACGATCCTCAACCCGTTTGATCGTCGCTCGTCGGGATGGACGTTGTTCAACGAGATCAAGGGC
GTGCATGACTTCGACCGGATGGCAAAAAGCGTCATCCCGCCGCAAATCGATCCAAGCGATGAGCAGTGGT
GTGCCTATGCTCGCGACGTGCTGGCCGACACCATGCGCAAGCTGGTCGAGACGAACAACCCGGATCAAGA
CACGCTGGTCAATCTGCTGGTGCGCGAGGACGGCGAAGTCATCCGCGCGTTTCTCGTCAACACGGATTCG
CAGGGCTACTTCCGCGATAACGCCGAGAAGGCCATCGCGTCGATCCAGTTCATGATGAACAAGTACGTGC
GGCCGCTGAGCTTCATGACCAAGGGCGATTTCTCGTTGCACAAGTGGGTGAATGACCCCAACGCCGGCAA
CCTGTTCGTCACGTGGCGCGAAGACATGCGAGCCGCGCAGCGCCCGCTTGTGGCGACATGGATCGACACG
ATTTGCGCGACGATTCTCAGTATCTCCGACGACGCGCAACACCTCTCCCGGCGTCTGTGGCTGTTCCTCG
ATGAGCTGGAATCGCTCGGCAGGCTTGAATCGTTCGTGCCGGCCGCGACGAAGGGCCGTAAGCACGGGCT
GCGCATGGCAGCCTCGATACAGGATTGGGCGCAGCTCGATGAGACCTACGGCAAGGATGCGGCCAAGACC
TTGCTCGGCTGCTTCCGCAATTACCTCATCTTTGGCGCGTCGAACGCGCTCAATGCTGACAAGGCGAGCG
AGATTCTTGGCAAGCAGCACGTTGAGCGCATCCAGATCACGACCAACGCGGGGGGGATCGGTGGAGGCGG
CCGCAGCCGCCATGTTATCGCCAGCCCACCGGAGCCGGTGGTATTGGACTCGGAAATCTCGAACCTCAAG
GACTTGGAGGGCTACGTCATGTTTGCCGAGGATTTCCCCATTGCGAAGATCAAGCTGCCCTACGTGAAGT
ATCCGCATCGAGCGGCCGCTATCGACATCAAGTGA
 Primer design